Viewing data for Plethodon cinereus


Scientific name Plethodon cinereus
Common name Eastern red-backed salamander
Maximum lifespan 25.00 years (Plethodon cinereus@AnAge)

Total mtDNA (size: 20001 bases) GC AT G C A T
Base content (bases) 7293 12707 4757 2536 5959 6748
Base content per 1 kb (bases) 365 635 238 127 298 337
Base content (%) 36.5% 63.5%
Total protein-coding genes (size: 11429 bases) GC AT G C A T
Base content (bases) 4256 7172 2845 1411 3546 3626
Base content per 1 kb (bases) 372 628 249 123 310 317
Base content (%) 37.2% 62.8%
D-loop (size: 3695 bases) GC AT G C A T
Base content (bases) 1262 2433 843 419 1116 1317
Base content per 1 kb (bases) 342 658 228 113 302 356
Base content (%) 34.2% 65.8%
Total tRNA-coding genes (size: 1530 bases) GC AT G C A T
Base content (bases) 532 998 316 216 446 552
Base content per 1 kb (bases) 348 652 207 141 292 361
Base content (%) 34.8% 65.2%
Total rRNA-coding genes (size: 2398 bases) GC AT G C A T
Base content (bases) 913 1485 513 400 593 892
Base content per 1 kb (bases) 381 619 214 167 247 372
Base content (%) 38.1% 61.9%
12S rRNA gene (size: 883 bases) GC AT G C A T
Base content (bases) 346 537 197 149 212 325
Base content per 1 kb (bases) 392 608 223 169 240 368
Base content (%) 39.2% 60.8%
16S rRNA gene (size: 1515 bases) GC AT G C A T
Base content (bases) 567 948 316 251 381 567
Base content per 1 kb (bases) 374 626 209 166 251 374
Base content (%) 37.4% 62.6%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 242 442 166 76 231 211
Base content per 1 kb (bases) 354 646 243 111 338 308
Base content (%) 35.4% 64.6%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 48 117 34 14 56 61
Base content per 1 kb (bases) 291 709 206 85 339 370
Base content (%) 29.1% 70.9%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 642 906 375 267 490 416
Base content per 1 kb (bases) 415 585 242 172 317 269
Base content (%) 41.5% 58.5%
COX2 (size: 807 bases) GC AT G C A T
Base content (bases) 317 490 207 110 210 280
Base content per 1 kb (bases) 393 607 257 136 260 347
Base content (%) 39.3% 60.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 318 466 194 124 242 224
Base content per 1 kb (bases) 406 594 247 158 309 286
Base content (%) 40.6% 59.4%
CYTB (size: 1138 bases) GC AT G C A T
Base content (bases) 394 744 262 132 397 347
Base content per 1 kb (bases) 346 654 230 116 349 305
Base content (%) 34.6% 65.4%
ND1 (size: 969 bases) GC AT G C A T
Base content (bases) 378 591 254 124 294 297
Base content per 1 kb (bases) 390 610 262 128 303 307
Base content (%) 39.0% 61.0%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 360 681 262 98 324 357
Base content per 1 kb (bases) 346 654 252 94 311 343
Base content (%) 34.6% 65.4%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 128 219 87 41 118 101
Base content per 1 kb (bases) 368 629 250 118 339 290
Base content (%) 36.8% 62.9%
ND4 (size: 1350 bases) GC AT G C A T
Base content (bases) 508 842 357 151 415 427
Base content per 1 kb (bases) 376 624 264 112 307 316
Base content (%) 37.6% 62.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 109 188 75 34 105 83
Base content per 1 kb (bases) 367 633 253 114 354 279
Base content (%) 36.7% 63.3%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 639 1182 444 195 574 608
Base content per 1 kb (bases) 351 649 244 107 315 334
Base content (%) 35.1% 64.9%
ND6 (size: 513 bases) GC AT G C A T
Base content (bases) 186 327 135 51 97 230
Base content per 1 kb (bases) 363 637 263 99 189 448
Base content (%) 36.3% 63.7%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 59 (25.99%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 5 (2.2%)
Asparagine (Asn, N)
n = 8 (3.52%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 5 (2.2%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 4 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 4 8 11 5 16 3 23 7 1 4 1 5 2 8 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 3 2 8 0 3 2 3 0 4 2 9 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 12 1 2 1 6 0 1 5 2 2 0 1 5 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 2 1 2 1 1 1 0 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
41 68 66 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 60 36 110
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 38 109 68
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPDPWFIIFIMSWFLFLIILMPHTSKLKLMNKPMMQHTYNKTTSWNWPWL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 3 (5.56%)
Threonine (Thr, T)
n = 4 (7.41%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 7 (12.96%)
Isoleucine (Ile, I)
n = 5 (9.26%)
Methionine (Met, M)
n = 6 (11.11%)
Proline (Pro, P)
n = 6 (11.11%)
Phenylalanine (Phe, F)
n = 4 (7.41%)
Tyrosine (Tyr, Y)
n = 1 (1.85%)
Tryptophan (Trp, W)
n = 5 (9.26%)
Aspartic acid (Asp, D)
n = 1 (1.85%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (7.41%)
Glutamine (Gln, Q)
n = 2 (3.7%)
Histidine (His, H)
n = 2 (3.7%)
Lysine (Lys, K)
n = 4 (7.41%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 4 1 0 1 0 5 2 0 0 0 0 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 0 0 0 0 0 0 0 1 1 2 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 1 0 1 0 0 1 1 0 1 0 3 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 0 1 2 2 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 12 24 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 12 15 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 10 22 16
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.93%)
Alanine (Ala, A)
n = 45 (8.74%)
Serine (Ser, S)
n = 30 (5.83%)
Threonine (Thr, T)
n = 36 (6.99%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.77%)
Leucine (Leu, L)
n = 61 (11.84%)
Isoleucine (Ile, I)
n = 35 (6.8%)
Methionine (Met, M)
n = 32 (6.21%)
Proline (Pro, P)
n = 28 (5.44%)
Phenylalanine (Phe, F)
n = 40 (7.77%)
Tyrosine (Tyr, Y)
n = 19 (3.69%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 14 (2.72%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 17 (3.3%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 20 (3.88%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 8 29 12 15 8 4 19 7 1 15 4 16 5 28 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 8 20 16 1 5 14 20 7 6 7 13 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 14 1 11 4 9 2 1 3 14 5 1 3 9 8 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 5 5 9 8 0 1 1 6 0 1 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
155 103 133 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 135 96 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 137 187 157
COX2 (size: 807 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (4.48%)
Alanine (Ala, A)
n = 17 (6.34%)
Serine (Ser, S)
n = 18 (6.72%)
Threonine (Thr, T)
n = 25 (9.33%)
Cysteine (Cys, C)
n = 2 (0.75%)
Valine (Val, V)
n = 12 (4.48%)
Leucine (Leu, L)
n = 31 (11.57%)
Isoleucine (Ile, I)
n = 25 (9.33%)
Methionine (Met, M)
n = 16 (5.97%)
Proline (Pro, P)
n = 19 (7.09%)
Phenylalanine (Phe, F)
n = 7 (2.61%)
Tyrosine (Tyr, Y)
n = 10 (3.73%)
Tryptophan (Trp, W)
n = 4 (1.49%)
Aspartic acid (Asp, D)
n = 10 (3.73%)
Glutamic acid (Glu, E)
n = 12 (4.48%)
Asparagine (Asn, N)
n = 10 (3.73%)
Glutamine (Gln, Q)
n = 10 (3.73%)
Histidine (His, H)
n = 10 (3.73%)
Lysine (Lys, K)
n = 10 (3.73%)
Arginine (Arg, R)
n = 8 (2.99%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 13 13 4 5 9 3 8 9 1 7 1 3 1 5 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 3 5 9 0 1 2 7 2 3 7 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 12 0 2 2 9 0 3 2 6 4 0 2 6 4 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 9 3 8 2 9 1 1 2 5 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 68 91 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 74 73 91
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 65 116 72
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 18 (6.92%)
Serine (Ser, S)
n = 14 (5.38%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 3 (1.15%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 26 (10.0%)
Tyrosine (Tyr, Y)
n = 8 (3.08%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 8 (3.08%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 6 10 8 5 9 0 10 7 0 2 4 9 2 18 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 4 4 10 0 0 5 11 4 3 3 6 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 10 0 3 3 4 0 0 4 5 3 1 1 6 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 2 1 3 2 0 0 2 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 61 62 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 61 53 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 72 109 68
CYTB (size: 1138 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.61%)
Alanine (Ala, A)
n = 16 (4.23%)
Serine (Ser, S)
n = 29 (7.67%)
Threonine (Thr, T)
n = 31 (8.2%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 13 (3.44%)
Leucine (Leu, L)
n = 66 (17.46%)
Isoleucine (Ile, I)
n = 39 (10.32%)
Methionine (Met, M)
n = 17 (4.5%)
Proline (Pro, P)
n = 20 (5.29%)
Phenylalanine (Phe, F)
n = 27 (7.14%)
Tyrosine (Tyr, Y)
n = 14 (3.7%)
Tryptophan (Trp, W)
n = 11 (2.91%)
Aspartic acid (Asp, D)
n = 7 (1.85%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 18 (4.76%)
Glutamine (Gln, Q)
n = 8 (2.12%)
Histidine (His, H)
n = 13 (3.44%)
Lysine (Lys, K)
n = 8 (2.12%)
Arginine (Arg, R)
n = 7 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 7 16 16 7 18 1 22 7 1 5 2 6 0 17 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 3 7 6 0 4 4 13 4 2 5 12 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 13 0 6 4 13 1 3 2 11 3 1 2 14 4 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 1 5 2 8 0 1 2 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 90 118 103
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 91 75 162
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 81 154 131
ND1 (size: 969 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.97%)
Alanine (Ala, A)
n = 27 (8.39%)
Serine (Ser, S)
n = 27 (8.39%)
Threonine (Thr, T)
n = 22 (6.83%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 11 (3.42%)
Leucine (Leu, L)
n = 58 (18.01%)
Isoleucine (Ile, I)
n = 22 (6.83%)
Methionine (Met, M)
n = 24 (7.45%)
Proline (Pro, P)
n = 22 (6.83%)
Phenylalanine (Phe, F)
n = 21 (6.52%)
Tyrosine (Tyr, Y)
n = 10 (3.11%)
Tryptophan (Trp, W)
n = 7 (2.17%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 11 (3.42%)
Asparagine (Asn, N)
n = 12 (3.73%)
Glutamine (Gln, Q)
n = 7 (2.17%)
Histidine (His, H)
n = 7 (2.17%)
Lysine (Lys, K)
n = 7 (2.17%)
Arginine (Arg, R)
n = 7 (2.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 5 22 9 7 20 2 19 7 0 3 2 4 2 16 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 1 14 11 1 1 6 6 3 2 4 14 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 8 1 3 8 10 2 1 3 6 4 0 1 5 7 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 9 2 2 1 5 2 1 0 6 0 0 0 0 1 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 81 91 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 94 58 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 79 148 75
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.76%)
Alanine (Ala, A)
n = 22 (6.36%)
Serine (Ser, S)
n = 36 (10.4%)
Threonine (Thr, T)
n = 34 (9.83%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 69 (19.94%)
Isoleucine (Ile, I)
n = 31 (8.96%)
Methionine (Met, M)
n = 35 (10.12%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 7 (2.02%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 11 (3.18%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 8 32 13 8 20 4 22 6 1 0 2 4 0 10 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 4 12 5 1 0 2 10 1 6 2 11 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 18 0 8 9 12 1 3 3 5 2 0 2 7 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 7 0 0 1 10 1 0 1 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 81 132 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 105 55 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 76 170 86
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.76%)
Alanine (Ala, A)
n = 22 (6.36%)
Serine (Ser, S)
n = 36 (10.4%)
Threonine (Thr, T)
n = 34 (9.83%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 69 (19.94%)
Isoleucine (Ile, I)
n = 31 (8.96%)
Methionine (Met, M)
n = 35 (10.12%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 7 (2.02%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 11 (3.18%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 8 32 13 8 20 4 22 6 1 0 2 4 0 10 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 4 12 5 1 0 2 10 1 6 2 11 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 18 0 8 9 12 1 3 3 5 2 0 2 7 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 7 0 0 1 10 1 0 1 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 81 132 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 105 55 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 76 170 86
ND4 (size: 1350 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.23%)
Alanine (Ala, A)
n = 28 (6.24%)
Serine (Ser, S)
n = 33 (7.35%)
Threonine (Thr, T)
n = 48 (10.69%)
Cysteine (Cys, C)
n = 6 (1.34%)
Valine (Val, V)
n = 9 (2.0%)
Leucine (Leu, L)
n = 86 (19.15%)
Isoleucine (Ile, I)
n = 40 (8.91%)
Methionine (Met, M)
n = 37 (8.24%)
Proline (Pro, P)
n = 27 (6.01%)
Phenylalanine (Phe, F)
n = 18 (4.01%)
Tyrosine (Tyr, Y)
n = 14 (3.12%)
Tryptophan (Trp, W)
n = 13 (2.9%)
Aspartic acid (Asp, D)
n = 3 (0.67%)
Glutamic acid (Glu, E)
n = 10 (2.23%)
Asparagine (Asn, N)
n = 13 (2.9%)
Glutamine (Gln, Q)
n = 13 (2.9%)
Histidine (His, H)
n = 11 (2.45%)
Lysine (Lys, K)
n = 11 (2.45%)
Arginine (Arg, R)
n = 10 (2.23%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 12 32 13 13 28 4 27 10 3 2 1 4 2 14 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 3 3 7 15 6 0 0 10 9 0 7 4 15 1 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 14 1 3 9 11 0 4 6 10 4 2 1 8 5 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 9 1 2 1 10 1 2 1 5 2 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 119 160 102
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
59 126 75 190
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 112 192 123
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 28 (28.57%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 2 (2.04%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 4 (4.08%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 2 (2.04%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 4 5 4 2 2 13 2 0 0 0 0 0 4 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 2 2 2 1 0 2 2 0 2 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 0 1 3 4 0 1 0 1 0 1 2 2 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 2 0 2 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
15 22 27 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
11 27 17 44
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 26 39 26
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (4.95%)
Alanine (Ala, A)
n = 37 (6.11%)
Serine (Ser, S)
n = 47 (7.76%)
Threonine (Thr, T)
n = 59 (9.74%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 18 (2.97%)
Leucine (Leu, L)
n = 98 (16.17%)
Isoleucine (Ile, I)
n = 60 (9.9%)
Methionine (Met, M)
n = 41 (6.77%)
Proline (Pro, P)
n = 29 (4.79%)
Phenylalanine (Phe, F)
n = 40 (6.6%)
Tyrosine (Tyr, Y)
n = 10 (1.65%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 10 (1.65%)
Asparagine (Asn, N)
n = 35 (5.78%)
Glutamine (Gln, Q)
n = 20 (3.3%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 24 (3.96%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
40 20 37 17 8 32 4 36 18 2 4 5 9 0 30 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 5 9 12 16 0 2 12 13 3 7 7 13 2 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 20 3 12 9 17 0 2 7 6 4 3 1 22 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 10 0 4 6 22 2 1 2 5 0 1 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
105 130 229 143
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 163 121 257
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 151 258 174
ND6 (size: 513 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (12.35%)
Alanine (Ala, A)
n = 15 (8.82%)
Serine (Ser, S)
n = 12 (7.06%)
Threonine (Thr, T)
n = 4 (2.35%)
Cysteine (Cys, C)
n = 3 (1.76%)
Valine (Val, V)
n = 22 (12.94%)
Leucine (Leu, L)
n = 26 (15.29%)
Isoleucine (Ile, I)
n = 13 (7.65%)
Methionine (Met, M)
n = 10 (5.88%)
Proline (Pro, P)
n = 3 (1.76%)
Phenylalanine (Phe, F)
n = 15 (8.82%)
Tyrosine (Tyr, Y)
n = 6 (3.53%)
Tryptophan (Trp, W)
n = 5 (2.94%)
Aspartic acid (Asp, D)
n = 3 (1.76%)
Glutamic acid (Glu, E)
n = 4 (2.35%)
Asparagine (Asn, N)
n = 4 (2.35%)
Glutamine (Gln, Q)
n = 1 (0.59%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.59%)
Arginine (Arg, R)
n = 2 (1.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 2 7 4 0 0 1 16 0 1 11 0 7 4 14 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 0 10 1 1 3 5 2 6 8 2 0 1 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 6 1 2 0 3 0 6 0 4 5 3 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 2 1 0 1 1 0 0 1 0 1 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 11 36 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 31 19 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 9 42 85
Total protein-coding genes (size: 11465 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 220 (5.76%)
Alanine (Ala, A)
n = 250 (6.54%)
Serine (Ser, S)
n = 278 (7.28%)
Threonine (Thr, T)
n = 329 (8.61%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 162 (4.24%)
Leucine (Leu, L)
n = 646 (16.91%)
Isoleucine (Ile, I)
n = 319 (8.35%)
Methionine (Met, M)
n = 250 (6.54%)
Proline (Pro, P)
n = 210 (5.5%)
Phenylalanine (Phe, F)
n = 237 (6.2%)
Tyrosine (Tyr, Y)
n = 106 (2.77%)
Tryptophan (Trp, W)
n = 106 (2.77%)
Aspartic acid (Asp, D)
n = 63 (1.65%)
Glutamic acid (Glu, E)
n = 93 (2.43%)
Asparagine (Asn, N)
n = 152 (3.98%)
Glutamine (Gln, Q)
n = 95 (2.49%)
Histidine (His, H)
n = 105 (2.75%)
Lysine (Lys, K)
n = 91 (2.38%)
Arginine (Arg, R)
n = 67 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
231 88 218 120 81 170 30 224 84 11 53 23 68 18 172 65
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
32 12 18 55 95 92 8 22 63 103 32 47 43 109 11 80
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
112 130 7 58 54 102 6 22 36 74 32 15 21 92 60 39
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
66 73 20 33 30 80 11 9 13 42 3 3 1 5 2 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
788 878 1203 951
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
485 1009 712 1614
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
228 879 1594 1119

Failed to understand id: ?term=("Plethodon cinereus"[Organism]) AND (refseq[filter] AND mitochondrion[filter])


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.