Viewing data for Melopsittacus undulatus


Scientific name Melopsittacus undulatus
Common name Budgerigar
Maximum lifespan 21.00 years (Melopsittacus undulatus@AnAge)

Total mtDNA (size: 18193 bases) GC AT G C A T
Base content (bases) 8129 10064 5772 2357 4400 5664
Base content per 1 kb (bases) 447 553 317 130 242 311
Base content (%) 44.7% 55.3%
Total protein-coding genes (size: 11379 bases) GC AT G C A T
Base content (bases) 5225 6154 3961 1264 2592 3562
Base content per 1 kb (bases) 459 541 348 111 228 313
Base content (%) 45.9% 54.1%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1539 bases) GC AT G C A T
Base content (bases) 643 896 392 251 377 519
Base content per 1 kb (bases) 418 582 255 163 245 337
Base content (%) 41.8% 58.2%
Total rRNA-coding genes (size: 2549 bases) GC AT G C A T
Base content (bases) 1234 1315 772 462 459 856
Base content per 1 kb (bases) 484 516 303 181 180 336
Base content (%) 48.4% 51.6%
12S rRNA gene (size: 977 bases) GC AT G C A T
Base content (bases) 474 503 297 177 175 328
Base content per 1 kb (bases) 485 515 304 181 179 336
Base content (%) 48.5% 51.5%
16S rRNA gene (size: 1572 bases) GC AT G C A T
Base content (bases) 760 812 475 285 284 528
Base content per 1 kb (bases) 483 517 302 181 181 336
Base content (%) 48.3% 51.7%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 306 378 247 59 168 210
Base content per 1 kb (bases) 447 553 361 86 246 307
Base content (%) 44.7% 55.3%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 70 98 63 7 35 63
Base content per 1 kb (bases) 417 583 375 42 208 375
Base content (%) 41.7% 58.3%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 741 807 508 233 359 448
Base content per 1 kb (bases) 479 521 328 151 232 289
Base content (%) 47.9% 52.1%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 314 370 221 93 159 211
Base content per 1 kb (bases) 459 541 323 136 232 308
Base content (%) 45.9% 54.1%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 365 419 256 109 188 231
Base content per 1 kb (bases) 466 534 327 139 240 295
Base content (%) 46.6% 53.4%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 527 613 390 137 292 321
Base content per 1 kb (bases) 462 538 342 120 256 282
Base content (%) 46.2% 53.8%
ND1 (size: 981 bases) GC AT G C A T
Base content (bases) 443 538 339 104 244 294
Base content per 1 kb (bases) 452 548 346 106 249 300
Base content (%) 45.2% 54.8%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 458 583 386 72 227 356
Base content per 1 kb (bases) 440 560 371 69 218 342
Base content (%) 44.0% 56.0%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 154 198 114 40 89 109
Base content per 1 kb (bases) 438 563 324 114 253 310
Base content (%) 43.8% 56.3%
ND4 (size: 1393 bases) GC AT G C A T
Base content (bases) 664 729 528 136 305 424
Base content per 1 kb (bases) 477 523 379 98 219 304
Base content (%) 47.7% 52.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 141 156 105 36 71 85
Base content per 1 kb (bases) 475 525 354 121 239 286
Base content (%) 47.5% 52.5%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 816 999 625 191 404 595
Base content per 1 kb (bases) 450 550 344 105 223 328
Base content (%) 45.0% 55.0%
ND6 (size: 510 bases) GC AT G C A T
Base content (bases) 230 280 181 49 56 224
Base content per 1 kb (bases) 451 549 355 96 110 439
Base content (%) 45.1% 54.9%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 14 (6.17%)
Threonine (Thr, T)
n = 27 (11.89%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (2.64%)
Leucine (Leu, L)
n = 57 (25.11%)
Isoleucine (Ile, I)
n = 22 (9.69%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 18 (7.93%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 17 9 10 16 23 1 7 7 1 2 2 2 0 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 10 4 0 0 4 4 0 1 5 12 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 0 0 2 7 0 0 5 1 2 0 0 3 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 1 3 0 1 2 2 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
34 85 77 32
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 69 34 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 93 99 33
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFFIMILSWLTFSLIIQPKMLSFTPTNHPTNKTPTTTKNNPWTWPWS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 9 (16.36%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 6 (10.91%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 2 0 2 2 0 1 2 0 0 0 0 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 1 5 3 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 4 0 0 1 3 0 0 0 0 0 1 0 1 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 0 0 3 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
0 16 25 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 22 13 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 25 25 4
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.13%)
Alanine (Ala, A)
n = 46 (8.93%)
Serine (Ser, S)
n = 28 (5.44%)
Threonine (Thr, T)
n = 41 (7.96%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 33 (6.41%)
Leucine (Leu, L)
n = 63 (12.23%)
Isoleucine (Ile, I)
n = 41 (7.96%)
Methionine (Met, M)
n = 23 (4.47%)
Proline (Pro, P)
n = 30 (5.83%)
Phenylalanine (Phe, F)
n = 41 (7.96%)
Tyrosine (Tyr, Y)
n = 18 (3.5%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 16 (3.11%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 34 22 7 14 37 1 4 10 0 1 11 20 1 7 34
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 7 29 10 0 4 12 30 1 3 10 17 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 14 0 4 11 10 0 0 3 5 13 0 0 1 15 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 10 0 1 14 9 0 0 0 8 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 125 134 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 142 96 201
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 241 218 52
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 19 (8.37%)
Threonine (Thr, T)
n = 17 (7.49%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 32 (14.1%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 4 (1.76%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 14 10 2 12 14 2 2 7 0 1 6 6 1 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 2 10 1 0 0 1 7 0 2 6 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 7 1 3 4 10 0 1 1 4 3 0 0 0 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 13 2 2 11 4 0 1 2 2 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 64 57 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 60 60 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 97 94 30
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 17 (6.54%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 36 (13.85%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 6 (2.31%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 10 (3.85%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 13 5 1 8 23 1 3 10 0 1 7 5 1 4 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 2 9 9 0 2 7 10 0 4 3 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 11 0 0 5 7 0 0 5 4 6 0 0 0 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 0 2 2 3 0 0 0 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 74 61 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 69 55 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 113 115 30
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.07%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 27 (7.12%)
Threonine (Thr, T)
n = 30 (7.92%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 16 (4.22%)
Leucine (Leu, L)
n = 63 (16.62%)
Isoleucine (Ile, I)
n = 32 (8.44%)
Methionine (Met, M)
n = 7 (1.85%)
Proline (Pro, P)
n = 24 (6.33%)
Phenylalanine (Phe, F)
n = 30 (7.92%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 11 (2.9%)
Aspartic acid (Asp, D)
n = 6 (1.58%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 21 (5.54%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 11 (2.9%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 25 5 4 17 30 3 9 8 0 1 4 10 1 8 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 5 15 7 0 2 7 13 1 3 10 11 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 8 0 4 13 8 0 0 2 2 11 1 0 4 17 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 1 3 3 10 1 1 3 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 105 103 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 106 78 148
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 179 140 51
ND1 (size: 981 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.68%)
Alanine (Ala, A)
n = 21 (6.44%)
Serine (Ser, S)
n = 30 (9.2%)
Threonine (Thr, T)
n = 29 (8.9%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (3.07%)
Leucine (Leu, L)
n = 66 (20.25%)
Isoleucine (Ile, I)
n = 24 (7.36%)
Methionine (Met, M)
n = 16 (4.91%)
Proline (Pro, P)
n = 27 (8.28%)
Phenylalanine (Phe, F)
n = 17 (5.21%)
Tyrosine (Tyr, Y)
n = 15 (4.6%)
Tryptophan (Trp, W)
n = 9 (2.76%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.37%)
Asparagine (Asn, N)
n = 12 (3.68%)
Glutamine (Gln, Q)
n = 5 (1.53%)
Histidine (His, H)
n = 3 (0.92%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 21 14 9 21 26 1 9 5 0 0 2 7 1 4 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 9 9 1 2 5 5 0 2 12 13 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 14 0 3 9 13 0 0 5 4 11 1 0 1 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 8 3 1 3 6 1 0 2 6 0 0 1 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 100 94 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 102 57 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 137 143 36
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 19 (5.49%)
Serine (Ser, S)
n = 32 (9.25%)
Threonine (Thr, T)
n = 56 (16.18%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 3 (0.87%)
Leucine (Leu, L)
n = 65 (18.79%)
Isoleucine (Ile, I)
n = 34 (9.83%)
Methionine (Met, M)
n = 17 (4.91%)
Proline (Pro, P)
n = 24 (6.94%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 27 16 4 21 36 0 4 10 0 0 0 3 0 3 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 0 13 6 0 0 7 5 0 4 9 11 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 24 0 3 11 15 0 2 1 0 6 1 0 2 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 0 1 13 1 0 1 2 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 105 138 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 128 58 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 153 160 31
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 19 (5.49%)
Serine (Ser, S)
n = 32 (9.25%)
Threonine (Thr, T)
n = 56 (16.18%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 3 (0.87%)
Leucine (Leu, L)
n = 65 (18.79%)
Isoleucine (Ile, I)
n = 34 (9.83%)
Methionine (Met, M)
n = 17 (4.91%)
Proline (Pro, P)
n = 24 (6.94%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 27 16 4 21 36 0 4 10 0 0 0 3 0 3 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 0 13 6 0 0 7 5 0 4 9 11 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 24 0 3 11 15 0 2 1 0 6 1 0 2 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 0 1 13 1 0 1 2 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 105 138 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 128 58 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 153 160 31
ND4 (size: 1393 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.67%)
Alanine (Ala, A)
n = 32 (6.91%)
Serine (Ser, S)
n = 37 (7.99%)
Threonine (Thr, T)
n = 54 (11.66%)
Cysteine (Cys, C)
n = 5 (1.08%)
Valine (Val, V)
n = 10 (2.16%)
Leucine (Leu, L)
n = 106 (22.89%)
Isoleucine (Ile, I)
n = 29 (6.26%)
Methionine (Met, M)
n = 26 (5.62%)
Proline (Pro, P)
n = 32 (6.91%)
Phenylalanine (Phe, F)
n = 13 (2.81%)
Tyrosine (Tyr, Y)
n = 15 (3.24%)
Tryptophan (Trp, W)
n = 12 (2.59%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 9 (1.94%)
Asparagine (Asn, N)
n = 12 (2.59%)
Glutamine (Gln, Q)
n = 15 (3.24%)
Histidine (His, H)
n = 17 (3.67%)
Lysine (Lys, K)
n = 10 (2.16%)
Arginine (Arg, R)
n = 10 (2.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 24 24 8 35 55 2 5 15 0 1 5 4 0 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 5 5 16 11 0 1 6 9 1 2 19 11 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 23 0 0 14 12 0 0 11 4 11 2 1 3 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 1 0 3 9 1 2 3 5 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 174 142 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 144 81 184
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 210 201 43
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 4 (4.08%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 5 1 6 9 1 3 3 0 0 0 1 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 1 6 2 0 1 1 1 1 0 1 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 0 3 4 3 0 0 4 0 2 0 0 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 2 1 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 31 26 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 31 18 36
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 43 41 11
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.3%)
Alanine (Ala, A)
n = 43 (7.12%)
Serine (Ser, S)
n = 49 (8.11%)
Threonine (Thr, T)
n = 80 (13.25%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 14 (2.32%)
Leucine (Leu, L)
n = 112 (18.54%)
Isoleucine (Ile, I)
n = 47 (7.78%)
Methionine (Met, M)
n = 25 (4.14%)
Proline (Pro, P)
n = 30 (4.97%)
Phenylalanine (Phe, F)
n = 32 (5.3%)
Tyrosine (Tyr, Y)
n = 13 (2.15%)
Tryptophan (Trp, W)
n = 11 (1.82%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 12 (1.99%)
Asparagine (Asn, N)
n = 27 (4.47%)
Glutamine (Gln, Q)
n = 19 (3.15%)
Histidine (His, H)
n = 12 (1.99%)
Lysine (Lys, K)
n = 24 (3.97%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 37 25 10 32 56 4 10 18 1 1 2 10 1 7 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 4 1 6 25 12 0 1 12 19 0 1 14 13 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
38 37 1 3 17 17 2 2 8 3 10 0 0 5 22 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 3 1 8 23 1 3 1 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
110 171 213 111
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 192 117 230
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 262 265 63
ND6 (size: 510 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.98%)
Alanine (Ala, A)
n = 11 (6.51%)
Serine (Ser, S)
n = 14 (8.28%)
Threonine (Thr, T)
n = 2 (1.18%)
Cysteine (Cys, C)
n = 2 (1.18%)
Valine (Val, V)
n = 35 (20.71%)
Leucine (Leu, L)
n = 26 (15.38%)
Isoleucine (Ile, I)
n = 2 (1.18%)
Methionine (Met, M)
n = 6 (3.55%)
Proline (Pro, P)
n = 4 (2.37%)
Phenylalanine (Phe, F)
n = 15 (8.88%)
Tyrosine (Tyr, Y)
n = 7 (4.14%)
Tryptophan (Trp, W)
n = 5 (2.96%)
Aspartic acid (Asp, D)
n = 4 (2.37%)
Glutamic acid (Glu, E)
n = 1 (0.59%)
Asparagine (Asn, N)
n = 1 (0.59%)
Glutamine (Gln, Q)
n = 1 (0.59%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.59%)
Arginine (Arg, R)
n = 5 (2.96%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 1 3 0 0 2 6 1 0 17 2 4 12 13 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 5 1 2 3 6 1 6 14 3 0 0 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 9 0 1 0 4 0 7 0 3 15 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 1 4 0 0 1 3 0 1 1 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 15 16 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 27 16 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
60 7 24 79
Total protein-coding genes (size: 11396 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 214 (5.64%)
Alanine (Ala, A)
n = 264 (6.95%)
Serine (Ser, S)
n = 292 (7.69%)
Threonine (Thr, T)
n = 388 (10.22%)
Cysteine (Cys, C)
n = 26 (0.68%)
Valine (Val, V)
n = 157 (4.13%)
Leucine (Leu, L)
n = 675 (17.78%)
Isoleucine (Ile, I)
n = 290 (7.64%)
Methionine (Met, M)
n = 159 (4.19%)
Proline (Pro, P)
n = 234 (6.16%)
Phenylalanine (Phe, F)
n = 217 (5.72%)
Tyrosine (Tyr, Y)
n = 112 (2.95%)
Tryptophan (Trp, W)
n = 108 (2.84%)
Aspartic acid (Asp, D)
n = 64 (1.69%)
Glutamic acid (Glu, E)
n = 91 (2.4%)
Asparagine (Asn, N)
n = 134 (3.53%)
Glutamine (Gln, Q)
n = 101 (2.66%)
Histidine (His, H)
n = 102 (2.69%)
Lysine (Lys, K)
n = 91 (2.4%)
Arginine (Arg, R)
n = 68 (1.79%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
58 232 141 60 188 328 18 65 99 2 25 41 73 18 59 158
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
18 9 17 38 148 74 4 20 64 112 18 27 95 109 3 40
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
185 160 3 35 91 109 2 9 46 34 78 11 16 21 113 15
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
87 79 12 14 50 85 6 11 15 41 1 0 2 8 1 97
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
790 1099 1119 790
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
473 1123 704 1498
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
135 1608 1580 475

Failed to understand id: ?term=("Melopsittacus undulatus"[Organism]) AND (refseq[filter] AND mitochondrion[filter])


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.