Viewing data for Merluccius merluccius


Scientific name Merluccius merluccius
Common name European hake
Maximum lifespan 20.00 years (Merluccius merluccius@AnAge)

Total mtDNA (size: 17078 bases) GC AT G C A T
Base content (bases) 8252 8826 5373 2879 4281 4545
Base content per 1 kb (bases) 483 517 315 169 251 266
Base content (%) 48.3% 51.7%
Total protein-coding genes (size: 11448 bases) GC AT G C A T
Base content (bases) 5657 5791 3849 1808 2904 2887
Base content per 1 kb (bases) 494 506 336 158 254 252
Base content (%) 49.4% 50.6%
D-loop (size: 871 bases) GC AT G C A T
Base content (bases) 321 550 197 124 297 253
Base content per 1 kb (bases) 369 631 226 142 341 290
Base content (%) 36.9% 63.1%
Total tRNA-coding genes (size: 1535 bases) GC AT G C A T
Base content (bases) 725 810 407 318 369 441
Base content per 1 kb (bases) 472 528 265 207 240 287
Base content (%) 47.2% 52.8%
Total rRNA-coding genes (size: 2609 bases) GC AT G C A T
Base content (bases) 1207 1402 656 551 571 831
Base content per 1 kb (bases) 463 537 251 211 219 319
Base content (%) 46.3% 53.7%
12S rRNA gene (size: 944 bases) GC AT G C A T
Base content (bases) 458 486 246 212 195 291
Base content per 1 kb (bases) 485 515 261 225 207 308
Base content (%) 48.5% 51.5%
16S rRNA gene (size: 1665 bases) GC AT G C A T
Base content (bases) 749 916 410 339 376 540
Base content per 1 kb (bases) 450 550 246 204 226 324
Base content (%) 45.0% 55.0%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 330 354 244 86 185 169
Base content per 1 kb (bases) 482 518 357 126 270 247
Base content (%) 48.2% 51.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 76 92 59 17 38 54
Base content per 1 kb (bases) 452 548 351 101 226 321
Base content (%) 45.2% 54.8%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 775 776 492 283 408 368
Base content per 1 kb (bases) 500 500 317 182 263 237
Base content (%) 50.0% 50.0%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 325 366 201 124 178 188
Base content per 1 kb (bases) 470 530 291 179 258 272
Base content (%) 47.0% 53.0%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 401 385 262 139 192 193
Base content per 1 kb (bases) 510 490 333 177 244 246
Base content (%) 51.0% 49.0%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 550 591 366 184 319 272
Base content per 1 kb (bases) 482 518 321 161 280 238
Base content (%) 48.2% 51.8%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 484 491 325 159 263 228
Base content per 1 kb (bases) 496 504 333 163 270 234
Base content (%) 49.6% 50.4%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 519 526 377 142 268 258
Base content per 1 kb (bases) 497 503 361 136 256 247
Base content (%) 49.7% 50.3%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 173 176 118 55 107 69
Base content per 1 kb (bases) 496 504 338 158 307 198
Base content (%) 49.6% 50.4%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 693 688 484 209 344 344
Base content per 1 kb (bases) 502 498 350 151 249 249
Base content (%) 50.2% 49.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 143 154 97 46 81 73
Base content per 1 kb (bases) 481 519 327 155 273 246
Base content (%) 48.1% 51.9%
ND5 (size: 1839 bases) GC AT G C A T
Base content (bases) 916 923 639 277 453 470
Base content per 1 kb (bases) 498 502 347 151 246 256
Base content (%) 49.8% 50.2%
ND6 (size: 564 bases) GC AT G C A T
Base content (bases) 278 286 189 89 74 212
Base content per 1 kb (bases) 493 507 335 158 131 376
Base content (%) 49.3% 50.7%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.41%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 14 (6.17%)
Threonine (Thr, T)
n = 24 (10.57%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 56 (24.67%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 14 (6.17%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 8 (3.52%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 6 (2.64%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 9 5 14 14 17 5 5 7 0 6 3 3 0 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 11 3 1 1 4 3 2 1 11 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 9 1 3 1 1 1 0 8 0 3 1 1 2 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 0 0 1 1 0 0 0 5 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 84 66 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 62 31 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 98 72 43
ATP8 (size: 168 bases)
Amino acid sequence: MPQLIPDPWFAIFMFTWTIFLTILPQKVMAHSFPNEPTPQSVTTPKTTPWNWPWH*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 8 (14.55%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 3 (5.45%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 5 (9.09%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 2 (3.64%)
Glutamine (Gln, Q)
n = 3 (5.45%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 1 0 0 1 0 2 2 1 0 0 2 0 0 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 0 1 1 0 0 0 0 3 5 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 3 0 1 0 0 0 0 1 0 0 1 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 0 0 1 2 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 16 20 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 21 12 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 22 22 7
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.91%)
Alanine (Ala, A)
n = 49 (9.5%)
Serine (Ser, S)
n = 30 (5.81%)
Threonine (Thr, T)
n = 35 (6.78%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 42 (8.14%)
Leucine (Leu, L)
n = 64 (12.4%)
Isoleucine (Ile, I)
n = 35 (6.78%)
Methionine (Met, M)
n = 26 (5.04%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 7 (1.36%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 18 16 13 23 20 7 1 9 0 9 14 12 7 15 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 1 5 28 16 0 3 21 15 7 6 14 7 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 14 2 6 9 9 1 2 3 6 12 2 0 4 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 7 3 2 13 6 1 0 2 6 1 0 0 0 1 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
162 128 122 105
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 93 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
43 227 153 94
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 19 (8.3%)
Serine (Ser, S)
n = 18 (7.86%)
Threonine (Thr, T)
n = 7 (3.06%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 20 (8.73%)
Leucine (Leu, L)
n = 26 (11.35%)
Isoleucine (Ile, I)
n = 20 (8.73%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 15 (6.55%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 3 (1.31%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 3 (1.31%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 7 7 9 1 10 1 5 5 3 5 8 6 1 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 2 8 7 2 2 3 2 2 1 9 3 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 0 3 5 5 0 0 5 3 7 0 0 1 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 4 1 14 3 0 0 2 3 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 59 50 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 53 63 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 89 75 46
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.05%)
Alanine (Ala, A)
n = 23 (8.81%)
Serine (Ser, S)
n = 12 (4.6%)
Threonine (Thr, T)
n = 24 (9.2%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 20 (7.66%)
Leucine (Leu, L)
n = 32 (12.26%)
Isoleucine (Ile, I)
n = 12 (4.6%)
Methionine (Met, M)
n = 7 (2.68%)
Proline (Pro, P)
n = 12 (4.6%)
Phenylalanine (Phe, F)
n = 25 (9.58%)
Tyrosine (Tyr, Y)
n = 11 (4.21%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.83%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 7 (2.68%)
Histidine (His, H)
n = 17 (6.51%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 6 (2.3%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 11 5 4 10 11 4 3 7 0 2 7 8 3 7 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 4 10 8 1 2 11 8 0 1 10 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 1 0 4 5 0 0 3 3 8 3 0 0 1 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 1 1 4 2 0 1 1 3 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 71 49 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 68 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 123 90 33
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 34 (8.97%)
Serine (Ser, S)
n = 19 (5.01%)
Threonine (Thr, T)
n = 21 (5.54%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 32 (8.44%)
Leucine (Leu, L)
n = 62 (16.36%)
Isoleucine (Ile, I)
n = 20 (5.28%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 34 (8.97%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 11 (2.9%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 20 (5.28%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 8 (2.11%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 13 10 9 19 18 6 10 4 2 4 12 14 2 11 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 9 16 8 1 0 11 7 6 4 15 3 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 0 6 5 6 1 0 1 3 10 1 0 4 16 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 3 2 8 5 3 0 3 4 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
107 100 84 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 95 76 162
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 171 112 67
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (5.25%)
Alanine (Ala, A)
n = 34 (10.49%)
Serine (Ser, S)
n = 25 (7.72%)
Threonine (Thr, T)
n = 23 (7.1%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 22 (6.79%)
Leucine (Leu, L)
n = 60 (18.52%)
Isoleucine (Ile, I)
n = 19 (5.86%)
Methionine (Met, M)
n = 11 (3.4%)
Proline (Pro, P)
n = 23 (7.1%)
Phenylalanine (Phe, F)
n = 20 (6.17%)
Tyrosine (Tyr, Y)
n = 12 (3.7%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 10 (3.09%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 9 4 7 23 15 6 5 4 3 6 10 5 1 7 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 7 15 12 0 1 9 4 3 3 13 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 7 1 3 8 9 0 1 4 5 7 1 4 3 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 8 3 1 3 6 1 1 0 5 2 0 0 0 1 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
88 92 75 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 100 55 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 133 98 61
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.32%)
Alanine (Ala, A)
n = 40 (11.53%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 42 (12.1%)
Cysteine (Cys, C)
n = 4 (1.15%)
Valine (Val, V)
n = 17 (4.9%)
Leucine (Leu, L)
n = 69 (19.88%)
Isoleucine (Ile, I)
n = 17 (4.9%)
Methionine (Met, M)
n = 14 (4.03%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 20 (5.76%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 4 (1.15%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 7 (2.02%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 8 8 12 29 13 5 9 13 1 3 8 6 0 6 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 4 6 26 8 0 0 8 6 1 3 10 7 2 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 17 1 3 8 6 1 2 3 3 3 1 1 2 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 1 0 4 7 2 1 1 2 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 106 94 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 122 50 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 149 114 62
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.32%)
Alanine (Ala, A)
n = 40 (11.53%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 42 (12.1%)
Cysteine (Cys, C)
n = 4 (1.15%)
Valine (Val, V)
n = 17 (4.9%)
Leucine (Leu, L)
n = 69 (19.88%)
Isoleucine (Ile, I)
n = 17 (4.9%)
Methionine (Met, M)
n = 14 (4.03%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 20 (5.76%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 4 (1.15%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 7 (2.02%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 8 8 12 29 13 5 9 13 1 3 8 6 0 6 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 4 6 26 8 0 0 8 6 1 3 10 7 2 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 17 1 3 8 6 1 2 3 3 3 1 1 2 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 1 0 4 7 2 1 1 2 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 106 94 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 122 50 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 149 114 62
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (5.45%)
Alanine (Ala, A)
n = 43 (9.37%)
Serine (Ser, S)
n = 30 (6.54%)
Threonine (Thr, T)
n = 39 (8.5%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 101 (22.0%)
Isoleucine (Ile, I)
n = 30 (6.54%)
Methionine (Met, M)
n = 26 (5.66%)
Proline (Pro, P)
n = 29 (6.32%)
Phenylalanine (Phe, F)
n = 17 (3.7%)
Tyrosine (Tyr, Y)
n = 13 (2.83%)
Tryptophan (Trp, W)
n = 17 (3.7%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 11 (2.4%)
Asparagine (Asn, N)
n = 14 (3.05%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 9 (1.96%)
Arginine (Arg, R)
n = 12 (2.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 16 17 16 39 25 9 10 11 0 5 4 7 0 11 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 3 6 25 12 0 0 10 11 4 4 17 5 3 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 15 2 3 13 4 0 3 7 3 10 7 2 0 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 4 0 2 8 1 1 5 3 3 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
97 152 128 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 131 71 190
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 201 145 70
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 11 (11.22%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 4 (4.08%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 2 3 6 5 6 1 5 3 0 1 0 1 1 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 1 2 6 3 0 0 3 2 1 0 1 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 1 1 4 2 0 1 1 0 1 1 0 0 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 0 0 1 0 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 29 23 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 28 16 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 40 34 16
ND5 (size: 1839 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 34 (5.56%)
Alanine (Ala, A)
n = 59 (9.64%)
Serine (Ser, S)
n = 47 (7.68%)
Threonine (Thr, T)
n = 58 (9.48%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 32 (5.23%)
Leucine (Leu, L)
n = 107 (17.48%)
Isoleucine (Ile, I)
n = 46 (7.52%)
Methionine (Met, M)
n = 26 (4.25%)
Proline (Pro, P)
n = 29 (4.74%)
Phenylalanine (Phe, F)
n = 33 (5.39%)
Tyrosine (Tyr, Y)
n = 9 (1.47%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 13 (2.12%)
Glutamic acid (Glu, E)
n = 11 (1.8%)
Asparagine (Asn, N)
n = 23 (3.76%)
Glutamine (Gln, Q)
n = 18 (2.94%)
Histidine (His, H)
n = 16 (2.61%)
Lysine (Lys, K)
n = 20 (3.27%)
Arginine (Arg, R)
n = 11 (1.8%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 25 16 21 37 25 12 11 12 6 9 12 9 2 13 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 6 4 41 13 1 3 17 10 4 4 21 4 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
29 20 3 6 18 8 1 2 12 3 6 2 1 4 19 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 11 0 3 10 15 5 1 3 5 2 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 169 187 108
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
79 179 111 244
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
49 291 172 101
ND6 (size: 564 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (15.51%)
Alanine (Ala, A)
n = 27 (14.44%)
Serine (Ser, S)
n = 9 (4.81%)
Threonine (Thr, T)
n = 2 (1.07%)
Cysteine (Cys, C)
n = 3 (1.6%)
Valine (Val, V)
n = 24 (12.83%)
Leucine (Leu, L)
n = 28 (14.97%)
Isoleucine (Ile, I)
n = 7 (3.74%)
Methionine (Met, M)
n = 6 (3.21%)
Proline (Pro, P)
n = 6 (3.21%)
Phenylalanine (Phe, F)
n = 17 (9.09%)
Tyrosine (Tyr, Y)
n = 8 (4.28%)
Tryptophan (Trp, W)
n = 4 (2.14%)
Aspartic acid (Asp, D)
n = 4 (2.14%)
Glutamic acid (Glu, E)
n = 7 (3.74%)
Asparagine (Asn, N)
n = 2 (1.07%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.53%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.6%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 2 2 6 1 3 2 10 0 0 11 1 4 8 11 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 1 9 6 5 7 8 2 3 16 4 0 1 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 5 0 3 0 1 0 7 1 3 6 1 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 7 2 2 0 0 0 0 0 3 1 0 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
91 22 19 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 43 22 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
57 24 33 74
Total protein-coding genes (size: 11471 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 242 (6.33%)
Alanine (Ala, A)
n = 365 (9.55%)
Serine (Ser, S)
n = 248 (6.49%)
Threonine (Thr, T)
n = 296 (7.75%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 246 (6.44%)
Leucine (Leu, L)
n = 661 (17.3%)
Isoleucine (Ile, I)
n = 237 (6.2%)
Methionine (Met, M)
n = 161 (4.21%)
Proline (Pro, P)
n = 221 (5.78%)
Phenylalanine (Phe, F)
n = 251 (6.57%)
Tyrosine (Tyr, Y)
n = 107 (2.8%)
Tryptophan (Trp, W)
n = 114 (2.98%)
Aspartic acid (Asp, D)
n = 79 (2.07%)
Glutamic acid (Glu, E)
n = 98 (2.56%)
Asparagine (Asn, N)
n = 110 (2.88%)
Glutamine (Gln, Q)
n = 96 (2.51%)
Histidine (His, H)
n = 107 (2.8%)
Lysine (Lys, K)
n = 69 (1.81%)
Arginine (Arg, R)
n = 77 (2.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
112 125 94 122 213 169 62 79 79 17 63 81 77 25 94 157
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
67 6 23 56 199 96 14 21 101 74 46 35 130 47 9 41
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
130 113 12 42 77 61 5 12 51 38 69 23 16 22 88 17
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
90 71 27 13 66 56 13 5 19 37 16 1 0 5 2 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1030 1067 937 788
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
526 1067 673 1556
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
354 1619 1150 699

Failed to understand id: ?term=("Merluccius merluccius"[Organism]) AND (refseq[filter] AND mitochondrion[filter])


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.