Viewing data for Canis lupus


Scientific name Canis lupus
Common name Gray wolf
Maximum lifespan 20.60 years (Canis lupus@AnAge)

Total mtDNA (size: 16729 bases) GC AT G C A T
Base content (bases) 6637 10088 4272 2365 4801 5287
Base content per 1 kb (bases) 397 603 255 141 287 316
Base content (%) 39.7% 60.3%
Total protein-coding genes (size: 11342 bases) GC AT G C A T
Base content (bases) 4511 6831 3055 1456 3352 3479
Base content per 1 kb (bases) 398 602 269 128 296 307
Base content (%) 39.8% 60.2%
D-loop (size: 1269 bases) GC AT G C A T
Base content (bases) 555 710 341 214 365 345
Base content per 1 kb (bases) 437 559 269 169 288 272
Base content (%) 43.7% 55.9%
Total tRNA-coding genes (size: 1516 bases) GC AT G C A T
Base content (bases) 552 964 310 242 445 519
Base content per 1 kb (bases) 364 636 204 160 294 342
Base content (%) 36.4% 63.6%
Total rRNA-coding genes (size: 2534 bases) GC AT G C A T
Base content (bases) 986 1548 544 442 625 923
Base content per 1 kb (bases) 389 611 215 174 247 364
Base content (%) 38.9% 61.1%
12S rRNA gene (size: 954 bases) GC AT G C A T
Base content (bases) 378 576 211 167 230 346
Base content per 1 kb (bases) 396 604 221 175 241 363
Base content (%) 39.6% 60.4%
16S rRNA gene (size: 1580 bases) GC AT G C A T
Base content (bases) 608 972 333 275 395 577
Base content per 1 kb (bases) 385 615 211 174 250 365
Base content (%) 38.5% 61.5%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 274 407 191 83 209 198
Base content per 1 kb (bases) 402 598 280 122 307 291
Base content (%) 40.2% 59.8%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 72 132 55 17 61 71
Base content per 1 kb (bases) 353 647 270 83 299 348
Base content (%) 35.3% 64.7%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 629 916 354 275 500 416
Base content per 1 kb (bases) 407 593 229 178 324 269
Base content (%) 40.7% 59.3%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 270 414 176 94 189 225
Base content per 1 kb (bases) 395 605 257 137 276 329
Base content (%) 39.5% 60.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 338 446 211 127 243 203
Base content per 1 kb (bases) 431 569 269 162 310 259
Base content (%) 43.1% 56.9%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 477 663 319 158 331 332
Base content per 1 kb (bases) 418 582 280 139 290 291
Base content (%) 41.8% 58.2%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 392 565 280 112 279 286
Base content per 1 kb (bases) 410 590 293 117 292 299
Base content (%) 41.0% 59.0%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 383 661 288 95 290 371
Base content per 1 kb (bases) 367 633 276 91 278 355
Base content (%) 36.7% 63.3%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 145 202 97 48 98 104
Base content per 1 kb (bases) 418 582 280 138 282 300
Base content (%) 41.8% 58.2%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 531 847 382 149 416 431
Base content per 1 kb (bases) 385 615 277 108 302 313
Base content (%) 38.5% 61.5%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 103 194 65 38 102 92
Base content per 1 kb (bases) 347 653 219 128 343 310
Base content (%) 34.7% 65.3%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 723 1098 508 215 537 561
Base content per 1 kb (bases) 397 603 279 118 295 308
Base content (%) 39.7% 60.3%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 200 328 146 54 117 211
Base content per 1 kb (bases) 379 621 277 102 222 400
Base content (%) 37.9% 62.1%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 20 (8.85%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 21 (9.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 42 (18.58%)
Isoleucine (Ile, I)
n = 27 (11.95%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 10 (4.42%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 10 10 5 5 21 2 8 8 1 3 2 3 2 8 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 8 5 6 1 2 3 4 2 4 7 2 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 6 2 2 3 5 0 3 1 2 1 0 1 6 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 0 0 1 2 2 0 2 2 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 66 77 39
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 64 37 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 61 84 67
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFIMIFSMFLTLFILFQLKISNHYYPENPMTKSAKIAGQHNPWENKWTKIYSLLSLPPQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.49%)
Alanine (Ala, A)
n = 2 (2.99%)
Serine (Ser, S)
n = 6 (8.96%)
Threonine (Thr, T)
n = 5 (7.46%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 8 (11.94%)
Isoleucine (Ile, I)
n = 6 (8.96%)
Methionine (Met, M)
n = 4 (5.97%)
Proline (Pro, P)
n = 6 (8.96%)
Phenylalanine (Phe, F)
n = 5 (7.46%)
Tyrosine (Tyr, Y)
n = 3 (4.48%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 4 (5.97%)
Glutamine (Gln, Q)
n = 4 (5.97%)
Histidine (His, H)
n = 2 (2.99%)
Lysine (Lys, K)
n = 5 (7.46%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 3 3 2 2 3 1 0 3 1 0 0 0 0 4 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 0 0 0 1 0 0 0 2 1 2 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 1 1 1 1 2 2 0 0 1 2 0 0 2 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 5 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 20 24 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 19 22 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 16 25 20
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 41 (7.98%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 39 (7.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 36 (7.0%)
Leucine (Leu, L)
n = 58 (11.28%)
Isoleucine (Ile, I)
n = 39 (7.59%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 14 22 13 4 15 7 17 5 2 7 6 18 5 21 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 1 0 13 10 17 1 11 6 23 7 11 9 6 2 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 15 4 10 10 4 3 1 2 10 9 1 2 11 6 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 8 2 7 8 7 2 1 0 6 1 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 100 140 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 135 96 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 119 180 166
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 10 15 5 5 12 1 9 5 2 5 2 4 2 5 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 2 4 2 1 1 2 5 0 2 4 7 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 7 0 7 3 4 0 1 3 6 5 0 2 1 5 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 12 3 0 10 3 1 0 0 6 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 56 67 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 61 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 66 97 51
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 14 (5.38%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 6 9 7 6 8 2 8 4 3 2 3 9 3 12 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 2 10 2 0 3 5 10 3 7 0 3 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 10 1 6 7 3 2 1 2 6 8 3 1 1 6 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 1 3 0 2 0 0 1 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 62 58 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 65 57 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 84 88 68
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 26 (6.86%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 20 (5.28%)
Leucine (Leu, L)
n = 58 (15.3%)
Isoleucine (Ile, I)
n = 38 (10.03%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 24 9 5 10 27 1 13 5 1 6 3 10 1 8 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 7 8 10 1 2 6 15 1 10 2 9 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 12 0 4 6 11 1 0 3 9 5 1 2 4 13 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 1 3 9 7 2 0 2 5 1 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
88 91 106 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 95 76 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 133 150 79
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 29 (9.12%)
Serine (Ser, S)
n = 21 (6.6%)
Threonine (Thr, T)
n = 20 (6.29%)
Cysteine (Cys, C)
n = 2 (0.63%)
Valine (Val, V)
n = 13 (4.09%)
Leucine (Leu, L)
n = 55 (17.3%)
Isoleucine (Ile, I)
n = 31 (9.75%)
Methionine (Met, M)
n = 19 (5.97%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 22 (6.92%)
Tyrosine (Tyr, Y)
n = 11 (3.46%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 13 (4.09%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 14 16 8 12 23 0 11 6 0 2 4 6 1 7 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 2 14 13 0 1 4 6 1 4 9 8 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 7 2 5 5 9 0 1 1 3 8 0 1 5 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 2 1 2 7 0 0 1 7 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 83 92 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 90 56 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 107 138 63
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.32%)
Alanine (Ala, A)
n = 18 (5.19%)
Serine (Ser, S)
n = 28 (8.07%)
Threonine (Thr, T)
n = 37 (10.66%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 57 (16.43%)
Isoleucine (Ile, I)
n = 39 (11.24%)
Methionine (Met, M)
n = 39 (11.24%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 11 (3.17%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 16 (4.61%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 4 (1.15%)
Lysine (Lys, K)
n = 15 (4.32%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 23 35 6 7 27 2 14 7 2 2 4 3 0 4 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 8 6 0 0 6 9 0 5 8 7 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 15 3 6 11 8 1 0 2 6 5 1 1 3 13 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 0 1 13 2 0 0 3 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 78 148 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 101 62 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 109 161 61
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.32%)
Alanine (Ala, A)
n = 18 (5.19%)
Serine (Ser, S)
n = 28 (8.07%)
Threonine (Thr, T)
n = 37 (10.66%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 57 (16.43%)
Isoleucine (Ile, I)
n = 39 (11.24%)
Methionine (Met, M)
n = 39 (11.24%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 11 (3.17%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 16 (4.61%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 4 (1.15%)
Lysine (Lys, K)
n = 15 (4.32%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 23 35 6 7 27 2 14 7 2 2 4 3 0 4 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 8 6 0 0 6 9 0 5 8 7 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 15 3 6 11 8 1 0 2 6 5 1 1 3 13 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 0 1 13 2 0 0 3 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 78 148 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 101 62 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 109 161 61
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 29 (6.33%)
Serine (Ser, S)
n = 38 (8.3%)
Threonine (Thr, T)
n = 35 (7.64%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 92 (20.09%)
Isoleucine (Ile, I)
n = 46 (10.04%)
Methionine (Met, M)
n = 34 (7.42%)
Proline (Pro, P)
n = 24 (5.24%)
Phenylalanine (Phe, F)
n = 20 (4.37%)
Tyrosine (Tyr, Y)
n = 18 (3.93%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 23 29 14 17 34 9 13 9 1 3 0 7 1 6 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 4 9 15 1 5 6 7 0 7 8 8 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 1 5 15 9 1 2 6 8 10 0 5 13 10 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 7 1 3 0 11 2 3 0 7 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 129 159 102
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 118 86 203
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 135 186 110
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 10 (10.2%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 11 (11.22%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 10 3 2 11 1 5 2 0 2 0 7 1 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 1 2 3 0 1 1 1 1 0 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 4 1 3 1 0 1 2 2 0 0 2 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 23 27 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 20 18 52
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 22 47 24
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (4.95%)
Alanine (Ala, A)
n = 36 (5.94%)
Serine (Ser, S)
n = 53 (8.75%)
Threonine (Thr, T)
n = 56 (9.24%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 20 (3.3%)
Leucine (Leu, L)
n = 89 (14.69%)
Isoleucine (Ile, I)
n = 59 (9.74%)
Methionine (Met, M)
n = 40 (6.6%)
Proline (Pro, P)
n = 24 (3.96%)
Phenylalanine (Phe, F)
n = 42 (6.93%)
Tyrosine (Tyr, Y)
n = 24 (3.96%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 10 (1.65%)
Asparagine (Asn, N)
n = 30 (4.95%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 24 (3.96%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 31 34 21 17 35 4 10 13 6 5 4 11 0 16 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 5 7 15 12 2 5 12 9 4 9 10 5 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 21 3 12 11 15 2 4 9 8 16 3 2 11 19 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 3 6 5 21 3 1 3 4 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
107 142 222 136
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 156 132 250
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 210 207 151
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (12.57%)
Alanine (Ala, A)
n = 11 (6.29%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 11 (6.29%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 22 (12.57%)
Leucine (Leu, L)
n = 21 (12.0%)
Isoleucine (Ile, I)
n = 15 (8.57%)
Methionine (Met, M)
n = 9 (5.14%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 12 (6.86%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 5 (2.86%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 3 4 1 0 2 2 7 1 0 8 0 6 8 12 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 7 1 0 3 10 2 3 7 2 0 1 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 1 4 0 2 0 4 1 6 3 1 9 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 5 4 1 1 3 1 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 10 48 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 31 32 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 13 37 82
Total protein-coding genes (size: 11409 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 216 (5.68%)
Alanine (Ala, A)
n = 251 (6.6%)
Serine (Ser, S)
n = 282 (7.42%)
Threonine (Thr, T)
n = 304 (8.0%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 185 (4.87%)
Leucine (Leu, L)
n = 594 (15.63%)
Isoleucine (Ile, I)
n = 343 (9.02%)
Methionine (Met, M)
n = 247 (6.5%)
Proline (Pro, P)
n = 193 (5.08%)
Phenylalanine (Phe, F)
n = 235 (6.18%)
Tyrosine (Tyr, Y)
n = 144 (3.79%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 69 (1.82%)
Glutamic acid (Glu, E)
n = 94 (2.47%)
Asparagine (Asn, N)
n = 157 (4.13%)
Glutamine (Gln, Q)
n = 89 (2.34%)
Histidine (His, H)
n = 95 (2.5%)
Lysine (Lys, K)
n = 100 (2.63%)
Arginine (Arg, R)
n = 65 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
175 168 202 95 91 231 33 117 69 20 47 28 86 24 109 126
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
45 4 21 61 87 91 12 43 53 93 27 64 62 60 7 76
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
90 120 18 68 75 76 13 17 33 69 75 11 27 65 92 38
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
57 75 19 29 40 80 20 6 10 45 4 1 0 8 1 93
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
815 892 1202 893
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
461 980 757 1604
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
281 1108 1447 966

Failed to understand id: ?term=("Canis lupus"[Organism]) AND (refseq[filter] AND mitochondrion[filter])


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.