Viewing data for Carassius auratus


Scientific name Carassius auratus
Common name Goldfish
Maximum lifespan 41.00 years (Carassius auratus@AnAge)

Total mtDNA (size: 16578 bases) GC AT G C A T
Base content (bases) 7056 9522 4380 2676 4311 5211
Base content per 1 kb (bases) 426 574 264 161 260 314
Base content (%) 42.6% 57.4%
Total protein-coding genes (size: 11396 bases) GC AT G C A T
Base content (bases) 4837 6559 3157 1680 3067 3492
Base content per 1 kb (bases) 424 576 277 147 269 306
Base content (%) 42.4% 57.6%
D-loop (size: 921 bases) GC AT G C A T
Base content (bases) 313 608 191 122 303 305
Base content per 1 kb (bases) 340 660 207 132 329 331
Base content (%) 34.0% 66.0%
Total tRNA-coding genes (size: 1566 bases) GC AT G C A T
Base content (bases) 692 874 378 314 394 480
Base content per 1 kb (bases) 442 558 241 201 252 307
Base content (%) 44.2% 55.8%
Total rRNA-coding genes (size: 2635 bases) GC AT G C A T
Base content (bases) 1194 1441 640 554 528 913
Base content per 1 kb (bases) 453 547 243 210 200 346
Base content (%) 45.3% 54.7%
12S rRNA gene (size: 954 bases) GC AT G C A T
Base content (bases) 462 492 253 209 187 305
Base content per 1 kb (bases) 484 516 265 219 196 320
Base content (%) 48.4% 51.6%
16S rRNA gene (size: 1681 bases) GC AT G C A T
Base content (bases) 732 949 387 345 341 608
Base content per 1 kb (bases) 435 565 230 205 203 362
Base content (%) 43.5% 56.5%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 264 420 170 94 205 215
Base content per 1 kb (bases) 386 614 249 137 300 314
Base content (%) 38.6% 61.4%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 62 103 42 20 45 58
Base content per 1 kb (bases) 376 624 255 121 273 352
Base content (%) 37.6% 62.4%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 668 883 404 264 453 430
Base content per 1 kb (bases) 431 569 260 170 292 277
Base content (%) 43.1% 56.9%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 280 411 170 110 190 221
Base content per 1 kb (bases) 405 595 246 159 275 320
Base content (%) 40.5% 59.5%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 350 436 226 124 211 225
Base content per 1 kb (bases) 445 555 288 158 268 286
Base content (%) 44.5% 55.5%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 482 659 317 165 332 327
Base content per 1 kb (bases) 422 578 278 145 291 287
Base content (%) 42.2% 57.8%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 434 541 281 153 257 284
Base content per 1 kb (bases) 445 555 288 157 264 291
Base content (%) 44.5% 55.5%
ND2 (size: 1047 bases) GC AT G C A T
Base content (bases) 483 564 332 151 229 335
Base content per 1 kb (bases) 461 539 317 144 219 320
Base content (%) 46.1% 53.9%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 144 207 93 51 110 97
Base content per 1 kb (bases) 410 590 265 145 313 276
Base content (%) 41.0% 59.0%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 564 817 378 186 379 438
Base content per 1 kb (bases) 408 592 274 135 274 317
Base content (%) 40.8% 59.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 137 160 89 48 87 73
Base content per 1 kb (bases) 461 539 300 162 293 246
Base content (%) 46.1% 53.9%
ND5 (size: 1824 bases) GC AT G C A T
Base content (bases) 735 1089 492 243 502 587
Base content per 1 kb (bases) 403 597 270 133 275 322
Base content (%) 40.3% 59.7%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 239 283 165 74 72 211
Base content per 1 kb (bases) 458 542 316 142 138 404
Base content (%) 45.8% 54.2%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 19 (8.37%)
Serine (Ser, S)
n = 10 (4.41%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 17 (7.49%)
Leucine (Leu, L)
n = 45 (19.82%)
Isoleucine (Ile, I)
n = 24 (10.57%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 12 (5.29%)
Tyrosine (Tyr, Y)
n = 5 (2.2%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 4 7 9 3 17 5 10 7 1 1 2 13 1 8 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 3 9 7 0 2 1 7 1 0 2 14 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 13 2 1 2 3 0 1 3 2 3 0 1 6 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 1 1 0 0 1 4 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 67 69 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 60 33 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 43 113 56
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPGPWFAILVFSWLVFLTIIPTKILSHISPNEPTPVSAEKHKTESWDWPW*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.85%)
Alanine (Ala, A)
n = 2 (3.7%)
Serine (Ser, S)
n = 5 (9.26%)
Threonine (Thr, T)
n = 4 (7.41%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.56%)
Leucine (Leu, L)
n = 5 (9.26%)
Isoleucine (Ile, I)
n = 5 (9.26%)
Methionine (Met, M)
n = 1 (1.85%)
Proline (Pro, P)
n = 8 (14.81%)
Phenylalanine (Phe, F)
n = 3 (5.56%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.26%)
Aspartic acid (Asp, D)
n = 1 (1.85%)
Glutamic acid (Glu, E)
n = 3 (5.56%)
Asparagine (Asn, N)
n = 2 (3.7%)
Glutamine (Gln, Q)
n = 1 (1.85%)
Histidine (His, H)
n = 2 (3.7%)
Lysine (Lys, K)
n = 3 (5.56%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 0 0 0 1 0 4 1 0 1 0 2 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 0 1 0 0 1 0 0 1 0 7 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 0 0 1 1 1 0 1 1 0 0 0 0 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 0 0 1 3 0 0 0 0 0 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
10 12 17 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 17 13 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 13 28 12
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.91%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 32 (6.2%)
Threonine (Thr, T)
n = 35 (6.78%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 43 (8.33%)
Leucine (Leu, L)
n = 64 (12.4%)
Isoleucine (Ile, I)
n = 38 (7.36%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 40 (7.75%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 14 14 15 11 25 6 7 7 1 9 5 26 3 17 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 1 9 21 15 1 10 7 26 3 7 7 13 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 21 1 9 4 14 0 1 4 11 8 0 0 7 8 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 10 1 3 11 8 0 1 1 6 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
160 120 125 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 136 95 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 148 210 132
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 17 (7.42%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 10 (4.37%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 20 (8.73%)
Leucine (Leu, L)
n = 28 (12.23%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 15 (6.55%)
Asparagine (Asn, N)
n = 6 (2.62%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 4 8 6 1 12 0 9 8 0 5 3 10 2 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 3 5 8 1 1 0 7 1 1 2 10 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 1 3 7 3 0 0 3 5 4 0 0 4 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 13 2 2 10 4 0 1 1 4 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 57 53 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 64 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 59 104 55
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.05%)
Alanine (Ala, A)
n = 23 (8.81%)
Serine (Ser, S)
n = 14 (5.36%)
Threonine (Thr, T)
n = 22 (8.43%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.75%)
Leucine (Leu, L)
n = 32 (12.26%)
Isoleucine (Ile, I)
n = 16 (6.13%)
Methionine (Met, M)
n = 8 (3.07%)
Proline (Pro, P)
n = 13 (4.98%)
Phenylalanine (Phe, F)
n = 23 (8.81%)
Tyrosine (Tyr, Y)
n = 12 (4.6%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.83%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 9 (3.45%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 9 6 5 5 13 2 7 9 0 4 1 9 1 8 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 7 7 9 0 0 6 14 1 2 5 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 12 0 1 5 5 0 0 3 7 5 0 0 0 1 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 9 1 1 4 2 0 1 1 3 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 68 52 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 69 56 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 89 117 49
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 30 (7.92%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 23 (6.07%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 23 (6.07%)
Leucine (Leu, L)
n = 61 (16.09%)
Isoleucine (Ile, I)
n = 33 (8.71%)
Methionine (Met, M)
n = 12 (3.17%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 30 (7.92%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 15 8 7 11 28 5 10 5 1 7 5 11 0 14 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 8 7 14 1 1 6 15 3 2 6 13 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 0 2 8 8 3 0 1 7 7 0 0 6 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 1 2 9 10 0 1 1 4 2 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
95 98 96 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 95 76 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 124 155 81
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 34 (10.49%)
Serine (Ser, S)
n = 21 (6.48%)
Threonine (Thr, T)
n = 21 (6.48%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 20 (6.17%)
Leucine (Leu, L)
n = 62 (19.14%)
Isoleucine (Ile, I)
n = 21 (6.48%)
Methionine (Met, M)
n = 11 (3.4%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 17 (5.25%)
Tyrosine (Tyr, Y)
n = 12 (3.7%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 13 (4.01%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 9 8 9 7 28 5 12 6 1 1 3 13 3 8 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 17 13 0 0 3 11 4 4 6 13 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 9 3 1 7 9 1 0 3 6 6 1 1 3 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 8 3 1 3 5 2 1 1 5 1 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
87 93 76 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 97 60 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 91 148 57
ND2 (size: 1047 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.17%)
Alanine (Ala, A)
n = 37 (10.63%)
Serine (Ser, S)
n = 21 (6.03%)
Threonine (Thr, T)
n = 53 (15.23%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.3%)
Leucine (Leu, L)
n = 67 (19.25%)
Isoleucine (Ile, I)
n = 24 (6.9%)
Methionine (Met, M)
n = 20 (5.75%)
Proline (Pro, P)
n = 19 (5.46%)
Phenylalanine (Phe, F)
n = 10 (2.87%)
Tyrosine (Tyr, Y)
n = 8 (2.3%)
Tryptophan (Trp, W)
n = 11 (3.16%)
Aspartic acid (Asp, D)
n = 5 (1.44%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 8 (2.3%)
Glutamine (Gln, Q)
n = 14 (4.02%)
Histidine (His, H)
n = 6 (1.72%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 9 15 9 4 39 7 7 12 2 0 2 4 2 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 2 17 17 1 2 3 10 3 1 10 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 22 4 2 5 6 1 0 7 1 7 2 1 3 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 1 4 4 5 0 1 1 2 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 102 121 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 123 56 129
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 107 158 47
ND3 (size: 1047 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.17%)
Alanine (Ala, A)
n = 37 (10.63%)
Serine (Ser, S)
n = 21 (6.03%)
Threonine (Thr, T)
n = 53 (15.23%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.3%)
Leucine (Leu, L)
n = 67 (19.25%)
Isoleucine (Ile, I)
n = 24 (6.9%)
Methionine (Met, M)
n = 20 (5.75%)
Proline (Pro, P)
n = 19 (5.46%)
Phenylalanine (Phe, F)
n = 10 (2.87%)
Tyrosine (Tyr, Y)
n = 8 (2.3%)
Tryptophan (Trp, W)
n = 11 (3.16%)
Aspartic acid (Asp, D)
n = 5 (1.44%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 8 (2.3%)
Glutamine (Gln, Q)
n = 14 (4.02%)
Histidine (His, H)
n = 6 (1.72%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 9 15 9 4 39 7 7 12 2 0 2 4 2 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 2 17 17 1 2 3 10 3 1 10 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 22 4 2 5 6 1 0 7 1 7 2 1 3 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 1 4 4 5 0 1 1 2 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 102 121 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 123 56 129
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 107 158 47
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (6.1%)
Alanine (Ala, A)
n = 34 (7.41%)
Serine (Ser, S)
n = 30 (6.54%)
Threonine (Thr, T)
n = 43 (9.37%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 17 (3.7%)
Leucine (Leu, L)
n = 86 (18.74%)
Isoleucine (Ile, I)
n = 41 (8.93%)
Methionine (Met, M)
n = 26 (5.66%)
Proline (Pro, P)
n = 27 (5.88%)
Phenylalanine (Phe, F)
n = 17 (3.7%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 11 (2.4%)
Asparagine (Asn, N)
n = 12 (2.61%)
Glutamine (Gln, Q)
n = 14 (3.05%)
Histidine (His, H)
n = 12 (2.61%)
Lysine (Lys, K)
n = 9 (1.96%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 15 19 14 14 34 4 18 13 1 3 3 10 1 10 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 5 6 14 14 0 2 9 15 2 3 7 16 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 26 2 4 7 13 0 1 5 7 7 0 2 4 8 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 10 1 1 2 8 1 0 0 10 1 0 0 0 0 20
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
93 130 137 100
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 128 75 187
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 120 226 91
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 13 (13.27%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 8 (8.16%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 3 3 2 13 1 3 2 1 1 0 1 0 5 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 3 6 4 0 1 2 3 0 0 2 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 1 2 2 2 0 1 2 0 0 0 1 1 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 0 0 1 0 0 1 0 1 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
25 31 20 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 29 14 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 29 39 24
ND5 (size: 1824 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.44%)
Alanine (Ala, A)
n = 52 (8.57%)
Serine (Ser, S)
n = 39 (6.43%)
Threonine (Thr, T)
n = 56 (9.23%)
Cysteine (Cys, C)
n = 5 (0.82%)
Valine (Val, V)
n = 27 (4.45%)
Leucine (Leu, L)
n = 95 (15.65%)
Isoleucine (Ile, I)
n = 53 (8.73%)
Methionine (Met, M)
n = 37 (6.1%)
Proline (Pro, P)
n = 26 (4.28%)
Phenylalanine (Phe, F)
n = 41 (6.75%)
Tyrosine (Tyr, Y)
n = 11 (1.81%)
Tryptophan (Trp, W)
n = 13 (2.14%)
Aspartic acid (Asp, D)
n = 13 (2.14%)
Glutamic acid (Glu, E)
n = 11 (1.81%)
Asparagine (Asn, N)
n = 29 (4.78%)
Glutamine (Gln, Q)
n = 20 (3.29%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 22 (3.62%)
Arginine (Arg, R)
n = 10 (1.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
37 16 30 12 19 41 9 14 20 0 10 4 11 2 21 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 4 10 23 17 2 3 8 19 3 3 7 16 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 27 2 3 8 15 2 7 4 5 6 1 0 9 20 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 2 3 10 18 4 0 1 8 1 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
136 151 208 113
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 162 121 253
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 179 258 136
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (15.03%)
Alanine (Ala, A)
n = 18 (10.4%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 29 (16.76%)
Leucine (Leu, L)
n = 32 (18.5%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 6 (3.47%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 9 (5.2%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 2 6 2 1 3 12 0 0 17 0 5 7 7 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 11 3 1 3 7 2 7 10 4 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 3 2 2 2 2 1 8 1 3 8 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 2 1 1 0 1 4 1 0 0 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 22 17 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 35 20 78
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 17 35 78
Total protein-coding genes (size: 11415 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 249 (6.55%)
Alanine (Ala, A)
n = 334 (8.78%)
Serine (Ser, S)
n = 236 (6.21%)
Threonine (Thr, T)
n = 308 (8.1%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 227 (5.97%)
Leucine (Leu, L)
n = 626 (16.46%)
Isoleucine (Ile, I)
n = 285 (7.49%)
Methionine (Met, M)
n = 176 (4.63%)
Proline (Pro, P)
n = 210 (5.52%)
Phenylalanine (Phe, F)
n = 228 (6.0%)
Tyrosine (Tyr, Y)
n = 115 (3.02%)
Tryptophan (Trp, W)
n = 120 (3.16%)
Aspartic acid (Asp, D)
n = 76 (2.0%)
Glutamic acid (Glu, E)
n = 101 (2.66%)
Asparagine (Asn, N)
n = 120 (3.16%)
Glutamine (Gln, Q)
n = 101 (2.66%)
Histidine (His, H)
n = 104 (2.73%)
Lysine (Lys, K)
n = 77 (2.02%)
Arginine (Arg, R)
n = 76 (2.0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
185 100 122 99 83 260 49 120 93 8 60 29 116 22 111 117
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
54 6 19 68 134 123 9 30 49 138 32 29 56 121 4 50
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
92 150 16 34 60 82 9 14 37 60 55 7 15 48 72 28
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
76 87 14 16 60 63 14 10 10 47 9 0 0 6 4 113
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
987 982 1017 818
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
521 1037 704 1542
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
266 1049 1641 848

Failed to understand id: ?term=("Carassius auratus"[Organism]) AND (refseq[filter] AND mitochondrion[filter])


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.