Viewing data for Micropterus salmoides


Scientific name Micropterus salmoides
Common name Largemouth bass
Maximum lifespan 23.00 years (Micropterus salmoides@AnAge)

Total mtDNA (size: 16484 bases) GC AT G C A T
Base content (bases) 7669 8815 4880 2789 4398 4417
Base content per 1 kb (bases) 465 535 296 169 267 268
Base content (%) 46.5% 53.5%
Total protein-coding genes (size: 11411 bases) GC AT G C A T
Base content (bases) 5387 6024 3621 1766 3172 2852
Base content per 1 kb (bases) 472 528 317 155 278 250
Base content (%) 47.2% 52.8%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1551 bases) GC AT G C A T
Base content (bases) 707 844 392 315 380 464
Base content per 1 kb (bases) 456 544 253 203 245 299
Base content (%) 45.6% 54.4%
Total rRNA-coding genes (size: 2636 bases) GC AT G C A T
Base content (bases) 1220 1416 663 557 570 846
Base content per 1 kb (bases) 463 537 252 211 216 321
Base content (%) 46.3% 53.7%
12S rRNA gene (size: 947 bases) GC AT G C A T
Base content (bases) 446 501 242 204 204 297
Base content per 1 kb (bases) 471 529 256 215 215 314
Base content (%) 47.1% 52.9%
16S rRNA gene (size: 1689 bases) GC AT G C A T
Base content (bases) 774 915 421 353 366 549
Base content per 1 kb (bases) 458 542 249 209 217 325
Base content (%) 45.8% 54.2%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 311 373 220 91 208 165
Base content per 1 kb (bases) 455 545 322 133 304 241
Base content (%) 45.5% 54.5%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 79 89 60 19 42 47
Base content per 1 kb (bases) 470 530 357 113 250 280
Base content (%) 47.0% 53.0%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 731 820 442 289 462 358
Base content per 1 kb (bases) 471 529 285 186 298 231
Base content (%) 47.1% 52.9%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 313 378 196 117 187 191
Base content per 1 kb (bases) 453 547 284 169 271 276
Base content (%) 45.3% 54.7%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 375 411 235 140 226 185
Base content per 1 kb (bases) 477 523 299 178 288 235
Base content (%) 47.7% 52.3%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 560 581 376 184 328 253
Base content per 1 kb (bases) 491 509 330 161 287 222
Base content (%) 49.1% 50.9%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 451 524 306 145 279 245
Base content per 1 kb (bases) 463 537 314 149 286 251
Base content (%) 46.3% 53.7%
ND2 (size: 1047 bases) GC AT G C A T
Base content (bases) 500 547 367 133 273 274
Base content per 1 kb (bases) 478 522 351 127 261 262
Base content (%) 47.8% 52.2%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 177 174 115 62 100 74
Base content per 1 kb (bases) 504 496 328 177 285 211
Base content (%) 50.4% 49.6%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 658 723 447 211 387 336
Base content per 1 kb (bases) 476 524 324 153 280 243
Base content (%) 47.6% 52.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 148 149 103 45 87 62
Base content per 1 kb (bases) 498 502 347 152 293 209
Base content (%) 49.8% 50.2%
ND5 (size: 1839 bases) GC AT G C A T
Base content (bases) 842 997 580 262 516 481
Base content per 1 kb (bases) 458 542 315 142 281 262
Base content (%) 45.8% 54.2%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 247 275 177 70 83 192
Base content per 1 kb (bases) 473 527 339 134 159 368
Base content (%) 47.3% 52.7%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 9 (3.96%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 57 (25.11%)
Isoleucine (Ile, I)
n = 16 (7.05%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 13 (5.73%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 6 5 15 15 18 1 5 7 2 6 2 5 2 9 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 9 5 1 4 4 2 1 3 8 5 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 7 0 0 4 0 0 0 5 0 4 2 3 6 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 1 0 1 1 0 0 2 4 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 84 62 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 60 32 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 76 71 64
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFAILVFSWLIFLTVLPPKVLAHTFPNEPSLQSTETPKTEPWNWPWH*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 5 (9.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 7 (12.73%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 0 1 2 4 0 0 2 0 0 3 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 2 0 0 0 0 0 5 4 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 1 0 0 0 1 1 0 1 0 0 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 2 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
9 21 14 12
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 20 13 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 19 20 13
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.72%)
Alanine (Ala, A)
n = 48 (9.3%)
Serine (Ser, S)
n = 30 (5.81%)
Threonine (Thr, T)
n = 36 (6.98%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 43 (8.33%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 40 (7.75%)
Methionine (Met, M)
n = 23 (4.46%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 13 14 22 13 12 9 6 5 3 13 15 10 5 20 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 1 8 19 19 2 10 14 12 9 9 13 5 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 16 2 5 12 6 2 3 2 2 16 4 0 5 10 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 3 3 11 7 1 3 0 3 2 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
161 119 127 110
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 137 94 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 186 137 142
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 19 (8.3%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 8 (3.49%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 18 (7.86%)
Leucine (Leu, L)
n = 28 (12.23%)
Isoleucine (Ile, I)
n = 21 (9.17%)
Methionine (Met, M)
n = 11 (4.8%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 15 (6.55%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 7 4 8 6 10 2 2 6 2 5 4 6 3 6 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 1 3 7 9 0 3 1 4 1 4 7 2 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 0 4 5 4 0 1 2 2 7 0 0 2 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 14 1 3 10 3 1 0 4 2 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 64 52 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 64 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 78 75 59
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.05%)
Alanine (Ala, A)
n = 24 (9.2%)
Serine (Ser, S)
n = 13 (4.98%)
Threonine (Thr, T)
n = 21 (8.05%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.13%)
Leucine (Leu, L)
n = 33 (12.64%)
Isoleucine (Ile, I)
n = 16 (6.13%)
Methionine (Met, M)
n = 8 (3.07%)
Proline (Pro, P)
n = 12 (4.6%)
Phenylalanine (Phe, F)
n = 23 (8.81%)
Tyrosine (Tyr, Y)
n = 12 (4.6%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.83%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 9 (3.45%)
Histidine (His, H)
n = 15 (5.75%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 7 6 8 9 5 5 5 7 2 4 6 4 2 10 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 1 12 9 2 6 10 5 0 6 6 0 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 8 2 3 3 2 2 0 3 6 6 1 1 1 1 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 2 0 5 2 0 0 1 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 68 52 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 67 56 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 100 77 64
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 35 (9.23%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 21 (5.54%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 25 (6.6%)
Leucine (Leu, L)
n = 63 (16.62%)
Isoleucine (Ile, I)
n = 27 (7.12%)
Methionine (Met, M)
n = 7 (1.85%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 31 (8.18%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 13 4 8 25 12 6 9 4 2 5 11 6 3 11 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 6 20 9 0 4 11 8 3 3 14 4 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 6 0 6 7 7 3 0 1 4 10 1 3 3 15 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 3 3 3 8 7 2 1 3 3 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
103 98 83 96
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 100 76 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 178 94 78
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 33 (10.19%)
Serine (Ser, S)
n = 20 (6.17%)
Threonine (Thr, T)
n = 23 (7.1%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 16 (4.94%)
Leucine (Leu, L)
n = 62 (19.14%)
Isoleucine (Ile, I)
n = 29 (8.95%)
Methionine (Met, M)
n = 10 (3.09%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 18 (5.56%)
Tyrosine (Tyr, Y)
n = 10 (3.09%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 12 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 13 8 13 13 19 5 11 4 2 5 3 8 0 9 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 23 6 0 3 7 2 6 6 11 6 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 7 2 4 4 9 0 0 3 6 4 0 1 5 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 8 3 2 2 5 2 0 3 3 2 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 93 84 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 97 56 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 116 105 78
ND2 (size: 1047 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.46%)
Alanine (Ala, A)
n = 37 (10.63%)
Serine (Ser, S)
n = 19 (5.46%)
Threonine (Thr, T)
n = 46 (13.22%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 81 (23.28%)
Isoleucine (Ile, I)
n = 21 (6.03%)
Methionine (Met, M)
n = 14 (4.02%)
Proline (Pro, P)
n = 23 (6.61%)
Phenylalanine (Phe, F)
n = 11 (3.16%)
Tyrosine (Tyr, Y)
n = 8 (2.3%)
Tryptophan (Trp, W)
n = 10 (2.87%)
Aspartic acid (Asp, D)
n = 2 (0.57%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 10 (2.87%)
Glutamine (Gln, Q)
n = 13 (3.74%)
Histidine (His, H)
n = 7 (2.01%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 9 9 26 25 16 7 5 11 2 3 1 4 1 8 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 7 17 13 0 2 7 6 4 2 14 6 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 14 1 3 7 6 0 0 3 1 7 0 2 5 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 2 0 8 1 1 0 2 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 121 103 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 122 55 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 124 116 84
ND3 (size: 1047 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.46%)
Alanine (Ala, A)
n = 37 (10.63%)
Serine (Ser, S)
n = 19 (5.46%)
Threonine (Thr, T)
n = 46 (13.22%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 81 (23.28%)
Isoleucine (Ile, I)
n = 21 (6.03%)
Methionine (Met, M)
n = 14 (4.02%)
Proline (Pro, P)
n = 23 (6.61%)
Phenylalanine (Phe, F)
n = 11 (3.16%)
Tyrosine (Tyr, Y)
n = 8 (2.3%)
Tryptophan (Trp, W)
n = 10 (2.87%)
Aspartic acid (Asp, D)
n = 2 (0.57%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 10 (2.87%)
Glutamine (Gln, Q)
n = 13 (3.74%)
Histidine (His, H)
n = 7 (2.01%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 9 9 26 25 16 7 5 11 2 3 1 4 1 8 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 7 17 13 0 2 7 6 4 2 14 6 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 14 1 3 7 6 0 0 3 1 7 0 2 5 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 2 0 8 1 1 0 2 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 121 103 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 122 55 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 124 116 84
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (6.1%)
Alanine (Ala, A)
n = 38 (8.28%)
Serine (Ser, S)
n = 30 (6.54%)
Threonine (Thr, T)
n = 44 (9.59%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 99 (21.57%)
Isoleucine (Ile, I)
n = 32 (6.97%)
Methionine (Met, M)
n = 25 (5.45%)
Proline (Pro, P)
n = 26 (5.66%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 13 (2.83%)
Tryptophan (Trp, W)
n = 19 (4.14%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 12 (2.61%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 10 11 29 27 28 4 9 8 2 6 7 3 0 11 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
14 1 3 4 24 9 1 3 15 7 3 7 13 5 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 16 3 4 14 5 0 1 6 5 8 4 2 3 9 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 7 5 1 3 5 5 2 3 6 0 0 0 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
98 146 130 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 131 72 188
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 170 134 112
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 12 (12.24%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 26 (26.53%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 4 (4.08%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 2 (2.04%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 1 4 8 8 2 4 3 0 2 0 1 0 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 5 5 1 1 0 4 1 0 2 0 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 2 0 3 1 5 0 0 2 0 0 1 0 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 0 1 1 0 0 1 0 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 34 17 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 31 14 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 38 31 23
ND5 (size: 1839 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.07%)
Alanine (Ala, A)
n = 58 (9.48%)
Serine (Ser, S)
n = 44 (7.19%)
Threonine (Thr, T)
n = 58 (9.48%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 28 (4.58%)
Leucine (Leu, L)
n = 97 (15.85%)
Isoleucine (Ile, I)
n = 47 (7.68%)
Methionine (Met, M)
n = 26 (4.25%)
Proline (Pro, P)
n = 32 (5.23%)
Phenylalanine (Phe, F)
n = 44 (7.19%)
Tyrosine (Tyr, Y)
n = 9 (1.47%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 11 (1.8%)
Glutamic acid (Glu, E)
n = 13 (2.12%)
Asparagine (Asn, N)
n = 30 (4.9%)
Glutamine (Gln, Q)
n = 18 (2.94%)
Histidine (His, H)
n = 17 (2.78%)
Lysine (Lys, K)
n = 18 (2.94%)
Arginine (Arg, R)
n = 11 (1.8%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 22 19 26 25 22 7 15 13 5 8 4 8 8 22 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 4 4 36 18 0 5 16 7 3 10 16 5 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
27 20 1 8 17 6 1 0 12 2 7 5 2 14 16 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 3 5 6 14 4 1 4 6 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
141 158 191 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 180 117 242
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 242 173 151
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.61%)
Alanine (Ala, A)
n = 19 (10.98%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 1 (0.58%)
Valine (Val, V)
n = 29 (16.76%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 7 (4.05%)
Proline (Pro, P)
n = 6 (3.47%)
Phenylalanine (Phe, F)
n = 9 (5.2%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 3 2 1 0 2 17 0 0 8 2 8 11 8 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 8 2 3 6 6 2 7 12 4 2 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 6 0 0 2 2 2 5 4 4 6 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 2 2 0 0 0 0 0 2 3 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 17 19 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 36 19 77
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 17 45 59
Total protein-coding genes (size: 11433 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 246 (6.46%)
Alanine (Ala, A)
n = 352 (9.24%)
Serine (Ser, S)
n = 237 (6.22%)
Threonine (Thr, T)
n = 301 (7.9%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 224 (5.88%)
Leucine (Leu, L)
n = 669 (17.56%)
Isoleucine (Ile, I)
n = 267 (7.01%)
Methionine (Met, M)
n = 147 (3.86%)
Proline (Pro, P)
n = 223 (5.85%)
Phenylalanine (Phe, F)
n = 234 (6.14%)
Tyrosine (Tyr, Y)
n = 108 (2.84%)
Tryptophan (Trp, W)
n = 119 (3.12%)
Aspartic acid (Asp, D)
n = 73 (1.92%)
Glutamic acid (Glu, E)
n = 103 (2.7%)
Asparagine (Asn, N)
n = 122 (3.2%)
Glutamine (Gln, Q)
n = 95 (2.49%)
Histidine (His, H)
n = 107 (2.81%)
Lysine (Lys, K)
n = 71 (1.86%)
Arginine (Arg, R)
n = 77 (2.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
160 107 85 171 177 158 53 90 73 22 65 61 63 35 121 113
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
62 7 18 54 181 104 13 46 93 63 44 62 111 41 9 59
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
126 104 12 46 76 52 12 8 43 34 74 24 20 48 74 38
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
69 76 27 23 50 55 16 9 21 38 9 0 0 9 1 95
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
998 1061 959 792
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
518 1062 689 1541
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
359 1394 1106 951

Failed to understand id: ?term=("Micropterus salmoides"[Organism]) AND (refseq[filter] AND mitochondrion[filter])


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.