Viewing data for Alligator sinensis


Scientific name Alligator sinensis
Common name Chinese alligator
Maximum lifespan 60.70 years (Alligator sinensis@AnAge)

Total mtDNA (size: 16746 bases) GC AT G C A T
Base content (bases) 7699 9047 5211 2488 4118 4929
Base content per 1 kb (bases) 460 540 311 149 246 294
Base content (%) 46.0% 54.0%
Total protein-coding genes (size: 11389 bases) GC AT G C A T
Base content (bases) 5311 6078 3750 1561 2881 3197
Base content per 1 kb (bases) 466 534 329 137 253 281
Base content (%) 46.6% 53.4%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 2443 bases) GC AT G C A T
Base content (bases) 1095 1348 691 404 612 736
Base content per 1 kb (bases) 448 552 283 165 251 301
Base content (%) 44.8% 55.2%
Total rRNA-coding genes (size: 2564 bases) GC AT G C A T
Base content (bases) 1204 1360 701 503 513 847
Base content per 1 kb (bases) 470 530 273 196 200 330
Base content (%) 47.0% 53.0%
12S rRNA gene (size: 985 bases) GC AT G C A T
Base content (bases) 485 500 278 207 177 323
Base content per 1 kb (bases) 492 508 282 210 180 328
Base content (%) 49.2% 50.8%
16S rRNA gene (size: 1579 bases) GC AT G C A T
Base content (bases) 719 860 423 296 336 524
Base content per 1 kb (bases) 455 545 268 187 213 332
Base content (%) 45.5% 54.5%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 309 375 225 84 184 191
Base content per 1 kb (bases) 452 548 329 123 269 279
Base content (%) 45.2% 54.8%
ATP8 (size: 183 bases) GC AT G C A T
Base content (bases) 86 97 69 17 39 58
Base content per 1 kb (bases) 470 530 377 93 213 317
Base content (%) 47.0% 53.0%
COX1 (size: 1578 bases) GC AT G C A T
Base content (bases) 746 832 483 263 415 417
Base content per 1 kb (bases) 473 527 306 167 263 264
Base content (%) 47.3% 52.7%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 322 366 221 101 170 196
Base content per 1 kb (bases) 468 532 321 147 247 285
Base content (%) 46.8% 53.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 383 401 257 126 201 200
Base content per 1 kb (bases) 489 511 328 161 256 255
Base content (%) 48.9% 51.1%
CYTB (size: 1138 bases) GC AT G C A T
Base content (bases) 538 600 380 158 291 309
Base content per 1 kb (bases) 473 527 334 139 256 272
Base content (%) 47.3% 52.7%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 454 512 315 139 253 259
Base content per 1 kb (bases) 470 530 326 144 262 268
Base content (%) 47.0% 53.0%
ND2 (size: 1065 bases) GC AT G C A T
Base content (bases) 480 585 350 130 272 313
Base content per 1 kb (bases) 451 549 329 122 255 294
Base content (%) 45.1% 54.9%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 161 187 114 47 92 95
Base content per 1 kb (bases) 463 537 328 135 264 273
Base content (%) 46.3% 53.7%
ND4 (size: 1374 bases) GC AT G C A T
Base content (bases) 633 741 462 171 361 380
Base content per 1 kb (bases) 461 539 336 124 263 277
Base content (%) 46.1% 53.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 133 164 95 38 81 83
Base content per 1 kb (bases) 448 552 320 128 273 279
Base content (%) 44.8% 55.2%
ND5 (size: 1812 bases) GC AT G C A T
Base content (bases) 842 970 605 237 453 517
Base content per 1 kb (bases) 465 535 334 131 250 285
Base content (%) 46.5% 53.5%
ND6 (size: 516 bases) GC AT G C A T
Base content (bases) 238 278 183 55 82 196
Base content per 1 kb (bases) 461 539 355 107 159 380
Base content (%) 46.1% 53.9%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 63 (27.75%)
Isoleucine (Ile, I)
n = 22 (9.69%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.32%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 16 6 12 11 21 5 11 8 0 0 4 2 2 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 8 2 1 1 6 1 3 3 3 8 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 2 2 6 3 0 0 4 0 3 1 3 2 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 1 0 5 0 0 1 2 2 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 81 71 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 62 34 108
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 82 86 36
ATP8 (size: 183 bases)
Amino acid sequence: MPQLNPEPWLTTLLITWISFIAFLQPKITSPAPVNDPTTRKPPTIKTWPWPWTQTCLINS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.33%)
Serine (Ser, S)
n = 3 (5.0%)
Threonine (Thr, T)
n = 10 (16.67%)
Cysteine (Cys, C)
n = 1 (1.67%)
Valine (Val, V)
n = 1 (1.67%)
Leucine (Leu, L)
n = 6 (10.0%)
Isoleucine (Ile, I)
n = 6 (10.0%)
Methionine (Met, M)
n = 1 (1.67%)
Proline (Pro, P)
n = 11 (18.33%)
Phenylalanine (Phe, F)
n = 2 (3.33%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (8.33%)
Aspartic acid (Asp, D)
n = 1 (1.67%)
Glutamic acid (Glu, E)
n = 1 (1.67%)
Asparagine (Asn, N)
n = 3 (5.0%)
Glutamine (Gln, Q)
n = 3 (5.0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.0%)
Arginine (Arg, R)
n = 1 (1.67%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 3 0 2 0 3 0 0 3 0 0 0 1 0 0 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 0 1 1 0 0 0 0 0 2 5 3 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 4 0 0 3 0 0 0 0 0 0 0 1 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 1 0 1 2 1 0 1 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 20 23 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 26 12 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 23 23 10
COX1 (size: 1578 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 43 (8.19%)
Alanine (Ala, A)
n = 41 (7.81%)
Serine (Ser, S)
n = 34 (6.48%)
Threonine (Thr, T)
n = 39 (7.43%)
Cysteine (Cys, C)
n = 2 (0.38%)
Valine (Val, V)
n = 39 (7.43%)
Leucine (Leu, L)
n = 63 (12.0%)
Isoleucine (Ile, I)
n = 37 (7.05%)
Methionine (Met, M)
n = 29 (5.52%)
Proline (Pro, P)
n = 31 (5.9%)
Phenylalanine (Phe, F)
n = 43 (8.19%)
Tyrosine (Tyr, Y)
n = 19 (3.62%)
Tryptophan (Trp, W)
n = 15 (2.86%)
Aspartic acid (Asp, D)
n = 15 (2.86%)
Glutamic acid (Glu, E)
n = 10 (1.9%)
Asparagine (Asn, N)
n = 18 (3.43%)
Glutamine (Gln, Q)
n = 10 (1.9%)
Histidine (His, H)
n = 19 (3.62%)
Lysine (Lys, K)
n = 9 (1.71%)
Arginine (Arg, R)
n = 9 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 20 25 10 19 19 3 8 9 1 2 15 16 6 16 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 5 22 12 2 2 11 22 8 1 17 10 3 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 17 1 6 15 7 1 1 4 6 13 3 4 4 14 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 2 5 10 8 1 1 2 5 1 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
148 120 138 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 140 100 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
40 223 179 84
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 13 (5.7%)
Serine (Ser, S)
n = 20 (8.77%)
Threonine (Thr, T)
n = 15 (6.58%)
Cysteine (Cys, C)
n = 5 (2.19%)
Valine (Val, V)
n = 13 (5.7%)
Leucine (Leu, L)
n = 32 (14.04%)
Isoleucine (Ile, I)
n = 16 (7.02%)
Methionine (Met, M)
n = 14 (6.14%)
Proline (Pro, P)
n = 13 (5.7%)
Phenylalanine (Phe, F)
n = 10 (4.39%)
Tyrosine (Tyr, Y)
n = 9 (3.95%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 11 (4.82%)
Glutamic acid (Glu, E)
n = 11 (4.82%)
Asparagine (Asn, N)
n = 8 (3.51%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 10 (4.39%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 10 11 5 9 8 6 3 6 1 1 5 6 1 2 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 5 2 6 5 0 1 2 3 2 2 5 4 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 5 1 1 10 5 1 0 3 3 6 1 1 1 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 11 0 3 8 4 0 3 1 1 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 63 60 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 58 60 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 100 76 34
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (6.92%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 26 (10.0%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 7 7 8 10 10 2 3 5 3 3 7 6 0 7 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 2 13 5 0 1 8 5 4 2 7 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 14 0 2 3 7 0 0 6 5 8 1 2 0 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 5 3 1 4 2 0 0 1 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 70 59 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 69 55 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 118 86 40
CYTB (size: 1138 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.61%)
Alanine (Ala, A)
n = 26 (6.88%)
Serine (Ser, S)
n = 30 (7.94%)
Threonine (Thr, T)
n = 33 (8.73%)
Cysteine (Cys, C)
n = 1 (0.26%)
Valine (Val, V)
n = 18 (4.76%)
Leucine (Leu, L)
n = 64 (16.93%)
Isoleucine (Ile, I)
n = 26 (6.88%)
Methionine (Met, M)
n = 19 (5.03%)
Proline (Pro, P)
n = 21 (5.56%)
Phenylalanine (Phe, F)
n = 26 (6.88%)
Tyrosine (Tyr, Y)
n = 13 (3.44%)
Tryptophan (Trp, W)
n = 11 (2.91%)
Aspartic acid (Asp, D)
n = 7 (1.85%)
Glutamic acid (Glu, E)
n = 6 (1.59%)
Asparagine (Asn, N)
n = 15 (3.97%)
Glutamine (Gln, Q)
n = 10 (2.65%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 8 (2.12%)
Arginine (Arg, R)
n = 8 (2.12%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 15 13 8 19 27 2 8 6 4 4 6 7 1 5 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 2 15 9 0 2 7 14 2 3 10 6 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 11 1 5 9 9 3 0 4 2 11 5 0 3 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 5 1 0 7 8 0 1 3 4 0 0 0 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 107 105 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 106 71 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 167 133 52
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.36%)
Alanine (Ala, A)
n = 29 (9.03%)
Serine (Ser, S)
n = 27 (8.41%)
Threonine (Thr, T)
n = 28 (8.72%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 13 (4.05%)
Leucine (Leu, L)
n = 67 (20.87%)
Isoleucine (Ile, I)
n = 18 (5.61%)
Methionine (Met, M)
n = 18 (5.61%)
Proline (Pro, P)
n = 24 (7.48%)
Phenylalanine (Phe, F)
n = 18 (5.61%)
Tyrosine (Tyr, Y)
n = 10 (3.12%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 5 (1.56%)
Glutamic acid (Glu, E)
n = 10 (3.12%)
Asparagine (Asn, N)
n = 8 (2.49%)
Glutamine (Gln, Q)
n = 5 (1.56%)
Histidine (His, H)
n = 4 (1.25%)
Lysine (Lys, K)
n = 7 (2.18%)
Arginine (Arg, R)
n = 7 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 12 13 12 10 25 9 11 4 1 5 4 3 1 10 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 2 16 10 1 1 4 6 3 0 12 11 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 2 3 9 8 2 0 5 3 7 1 0 0 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 4 0 5 7 0 0 1 4 2 0 0 0 1 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 96 84 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 103 50 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 116 125 48
ND2 (size: 1065 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (2.54%)
Alanine (Ala, A)
n = 32 (9.04%)
Serine (Ser, S)
n = 34 (9.6%)
Threonine (Thr, T)
n = 43 (12.15%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 16 (4.52%)
Leucine (Leu, L)
n = 72 (20.34%)
Isoleucine (Ile, I)
n = 26 (7.34%)
Methionine (Met, M)
n = 16 (4.52%)
Proline (Pro, P)
n = 18 (5.08%)
Phenylalanine (Phe, F)
n = 15 (4.24%)
Tyrosine (Tyr, Y)
n = 8 (2.26%)
Tryptophan (Trp, W)
n = 9 (2.54%)
Aspartic acid (Asp, D)
n = 2 (0.56%)
Glutamic acid (Glu, E)
n = 7 (1.98%)
Asparagine (Asn, N)
n = 9 (2.54%)
Glutamine (Gln, Q)
n = 11 (3.11%)
Histidine (His, H)
n = 5 (1.41%)
Lysine (Lys, K)
n = 17 (4.8%)
Arginine (Arg, R)
n = 5 (1.41%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 15 12 11 18 26 9 8 9 2 2 6 4 4 7 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 7 13 10 2 1 3 5 0 2 6 8 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 15 2 2 16 8 2 1 5 4 4 4 0 4 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 1 1 1 16 1 0 1 3 1 1 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 103 118 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 121 59 145
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 126 136 59
ND3 (size: 1065 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (2.54%)
Alanine (Ala, A)
n = 32 (9.04%)
Serine (Ser, S)
n = 34 (9.6%)
Threonine (Thr, T)
n = 43 (12.15%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 16 (4.52%)
Leucine (Leu, L)
n = 72 (20.34%)
Isoleucine (Ile, I)
n = 26 (7.34%)
Methionine (Met, M)
n = 16 (4.52%)
Proline (Pro, P)
n = 18 (5.08%)
Phenylalanine (Phe, F)
n = 15 (4.24%)
Tyrosine (Tyr, Y)
n = 8 (2.26%)
Tryptophan (Trp, W)
n = 9 (2.54%)
Aspartic acid (Asp, D)
n = 2 (0.56%)
Glutamic acid (Glu, E)
n = 7 (1.98%)
Asparagine (Asn, N)
n = 9 (2.54%)
Glutamine (Gln, Q)
n = 11 (3.11%)
Histidine (His, H)
n = 5 (1.41%)
Lysine (Lys, K)
n = 17 (4.8%)
Arginine (Arg, R)
n = 5 (1.41%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 15 12 11 18 26 9 8 9 2 2 6 4 4 7 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 7 13 10 2 1 3 5 0 2 6 8 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 15 2 2 16 8 2 1 5 4 4 4 0 4 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 1 1 1 16 1 0 1 3 1 1 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 103 118 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 121 59 145
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 126 136 59
ND4 (size: 1374 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (3.5%)
Alanine (Ala, A)
n = 43 (9.41%)
Serine (Ser, S)
n = 34 (7.44%)
Threonine (Thr, T)
n = 44 (9.63%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 12 (2.63%)
Leucine (Leu, L)
n = 101 (22.1%)
Isoleucine (Ile, I)
n = 34 (7.44%)
Methionine (Met, M)
n = 31 (6.78%)
Proline (Pro, P)
n = 29 (6.35%)
Phenylalanine (Phe, F)
n = 17 (3.72%)
Tyrosine (Tyr, Y)
n = 11 (2.41%)
Tryptophan (Trp, W)
n = 10 (2.19%)
Aspartic acid (Asp, D)
n = 7 (1.53%)
Glutamic acid (Glu, E)
n = 6 (1.31%)
Asparagine (Asn, N)
n = 16 (3.5%)
Glutamine (Gln, Q)
n = 16 (3.5%)
Histidine (His, H)
n = 10 (2.19%)
Lysine (Lys, K)
n = 8 (1.75%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 19 23 21 24 30 8 11 16 0 0 3 9 0 7 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 2 7 22 11 3 3 6 4 3 3 15 9 2 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 15 1 3 10 9 2 2 8 2 9 2 7 3 13 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 0 1 6 8 0 1 3 3 2 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 147 143 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 140 75 195
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 175 162 82
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 12 (12.24%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 4 (4.08%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 7 (7.14%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 1 (1.02%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 5 6 3 4 8 4 1 1 0 1 3 0 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 2 1 4 2 1 1 3 0 0 0 0 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 7 0 2 3 5 0 1 1 0 1 0 1 0 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 1 1 0 0 1 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 26 33 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
11 29 15 44
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 40 35 15
ND5 (size: 1812 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (4.15%)
Alanine (Ala, A)
n = 58 (9.62%)
Serine (Ser, S)
n = 50 (8.29%)
Threonine (Thr, T)
n = 61 (10.12%)
Cysteine (Cys, C)
n = 6 (1.0%)
Valine (Val, V)
n = 22 (3.65%)
Leucine (Leu, L)
n = 98 (16.25%)
Isoleucine (Ile, I)
n = 42 (6.97%)
Methionine (Met, M)
n = 30 (4.98%)
Proline (Pro, P)
n = 31 (5.14%)
Phenylalanine (Phe, F)
n = 41 (6.8%)
Tyrosine (Tyr, Y)
n = 15 (2.49%)
Tryptophan (Trp, W)
n = 10 (1.66%)
Aspartic acid (Asp, D)
n = 13 (2.16%)
Glutamic acid (Glu, E)
n = 9 (1.49%)
Asparagine (Asn, N)
n = 24 (3.98%)
Glutamine (Gln, Q)
n = 18 (2.99%)
Histidine (His, H)
n = 16 (2.65%)
Lysine (Lys, K)
n = 27 (4.48%)
Arginine (Arg, R)
n = 7 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 22 19 13 27 32 11 12 14 4 4 9 8 1 13 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 0 6 9 28 20 1 0 11 12 2 2 20 8 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
36 14 0 5 11 17 2 1 14 5 10 2 3 5 19 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 4 3 10 22 5 1 3 3 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
127 155 199 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
63 185 123 233
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 265 195 97
ND6 (size: 516 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (14.04%)
Alanine (Ala, A)
n = 10 (5.85%)
Serine (Ser, S)
n = 11 (6.43%)
Threonine (Thr, T)
n = 3 (1.75%)
Cysteine (Cys, C)
n = 8 (4.68%)
Valine (Val, V)
n = 29 (16.96%)
Leucine (Leu, L)
n = 20 (11.7%)
Isoleucine (Ile, I)
n = 9 (5.26%)
Methionine (Met, M)
n = 9 (5.26%)
Proline (Pro, P)
n = 3 (1.75%)
Phenylalanine (Phe, F)
n = 17 (9.94%)
Tyrosine (Tyr, Y)
n = 4 (2.34%)
Tryptophan (Trp, W)
n = 8 (4.68%)
Aspartic acid (Asp, D)
n = 2 (1.17%)
Glutamic acid (Glu, E)
n = 6 (3.51%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.17%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 4 (2.34%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 4 3 2 1 2 4 5 0 0 3 2 11 13 14 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 8 0 4 1 2 3 4 2 3 15 2 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 2 1 1 2 0 6 1 4 0 3 6 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 6 2 0 0 1 2 0 1 1 1 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 18 31 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 20 16 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
60 17 35 60
Total protein-coding genes (size: 11433 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 202 (5.3%)
Alanine (Ala, A)
n = 306 (8.03%)
Serine (Ser, S)
n = 293 (7.69%)
Threonine (Thr, T)
n = 344 (9.03%)
Cysteine (Cys, C)
n = 33 (0.87%)
Valine (Val, V)
n = 193 (5.07%)
Leucine (Leu, L)
n = 665 (17.46%)
Isoleucine (Ile, I)
n = 268 (7.04%)
Methionine (Met, M)
n = 198 (5.2%)
Proline (Pro, P)
n = 215 (5.64%)
Phenylalanine (Phe, F)
n = 231 (6.06%)
Tyrosine (Tyr, Y)
n = 108 (2.84%)
Tryptophan (Trp, W)
n = 101 (2.65%)
Aspartic acid (Asp, D)
n = 72 (1.89%)
Glutamic acid (Glu, E)
n = 86 (2.26%)
Asparagine (Asn, N)
n = 123 (3.23%)
Glutamine (Gln, Q)
n = 98 (2.57%)
Histidine (His, H)
n = 102 (2.68%)
Lysine (Lys, K)
n = 94 (2.47%)
Arginine (Arg, R)
n = 68 (1.79%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
110 158 143 111 156 221 65 84 81 17 25 64 75 29 88 143
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
55 13 20 45 156 91 14 17 66 77 42 23 105 71 16 55
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
151 126 12 33 98 82 13 12 55 34 74 24 28 24 99 15
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
87 61 25 18 54 85 9 9 18 32 9 3 0 4 3 77
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
859 1036 1097 818
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
474 1091 690 1555
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
361 1504 1313 632

<!DOCTYPE html>
<html lang="en" >
<head >
    <meta charset="UTF-8">
    <meta http-equiv="X-UA-Compatible" content="IE=edge">
    <meta name="HandheldFriendly" content="True">
    <meta name="MobileOptimized" content="320">
    <meta name="viewport" content="width=device-width, initial-scale=1.0">
    <title>400 Error - NCBI</title>
    <meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no">
    <meta http-equiv="X-UA-Compatible" content="IE=edge" />
    <meta http-equiv="Content-Type" content="text/html; charset=utf-8" />
    <meta http-equiv="X-UA-Compatible" content="IE=edge,chrome=1" />
    <meta name="title" content="400 Error - NCBI">
    <meta name="robots" content="noindex">
    <meta name="googlebot" content="noindex">
    <style>

      /* USWDS Banner Styles */
      .usa-banner{
        background-color:#f1f1f1;
        padding-bottom:0.7rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner{
          font-size:1.3rem;
          padding-bottom:0;
        }
      }

      .usa-banner .usa-accordion, .usa-banner .usa-accordion-bordered{
        margin-top:0;
        margin-bottom:0;
        list-style-type:none;
        padding-left:0;
        color:#212121;
        margin:0;
        padding:0;
        width:100%;
      }

      .usa-banner .usa-banner-header{
        padding-top:0.55rem;
        padding-bottom:0.55rem;
        font-size:0.75rem;
        font-weight:400;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header{
          padding-top:0;
          padding-bottom:0;
        }
      }

      .usa-banner .usa-banner-inner{
        max-width:1040px;
        margin-left:auto;
        margin-right:auto;
        padding-right:1.5rem;
        padding-left:1.5rem;
      }

      .usa-banner .usa-banner-inner::after{
        clear:both;
        content:"";
        display:block;
      }

      @media screen and (min-width: 951px){
        .usa-banner .usa-banner-inner{
          padding-right:3rem;
          padding-left:3rem;
        }
      }

      .usa-banner .usa-banner-header-expanded{
        -ms-flex-align:center;
        align-items:center;
        border-bottom:1px solid #aeb0b5;
        display:-ms-flexbox;
        display:flex;
        font-size:0.75rem;
        min-height:0rem;
        padding-right:3rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header-expanded{
          border-bottom:none;
          display:block;
          font-size:0.75rem;
          font-weight:400;
          min-height:0;
          padding-right:0;
        }
      }

      .usa-banner .usa-banner-header-expanded > .usa-banner-inner{
        margin-left:0;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header-expanded > .usa-banner-inner{
          margin-left:auto;
        }
      }

      .usa-banner .usa-section > :first-child,
      .usa-banner .usa-grid > :first-child,
      .usa-banner .usa-grid-full > :first-child{
        margin-top:0;
      }

      .usa-banner .usa-section > :last-child,
      .usa-banner .usa-grid > :last-child,
      .usa-banner .usa-grid-full > :last-child{
        margin-bottom:0;
      }

      .usa-banner img{
        border:0;
      }

      .usa-banner img{
        max-width:100%;
      }

      .usa-banner .usa-banner-header img{
        float:left;
        margin-right:1rem;
        margin-top:1px;
        width:1.5rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header img{
          margin-right:0.7rem;
          width:1.3rem;
        }
      }

      .usa-banner .usa-banner-header-expanded img{
        margin-right:1rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header-expanded img{
          margin-right:0.7rem;
        }
      }

      .usa-banner p{
        line-height:1.5;
        /*margin-bottom:1em;
        margin-top:1em;*/
      }

      .usa-banner .usa-banner-header p{
        margin-top:0;
        margin-bottom:0;
        display:inline;
        overflow:hidden;
        vertical-align:middle;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header p{
          margin-top:2px;
          margin-bottom:2px;
          display:inline-block;
        }
      }

      .usa-banner .usa-banner-header-expanded p{
        line-height:1.3;
        vertical-align:top;
        font-size: 0.95rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header-expanded p{
          line-height:1.5;
          vertical-align:middle;
          font-size: 0.75rem;
        }
      }

      .usa-banner .usa-accordion-button.usa-banner-button{
        background-color:transparent;
        border:0;
        border-radius:0;
        font-weight:400;
        margin:0;
        padding:0;
        text-align:left;
        -webkit-font-smoothing:auto;
        padding-top:0;
        padding-left:4.0rem;
        background-position-x:right;
        color:#0071bc;
        display:block;
        font-size:0.7rem;
        height:4.3rem;
        left:0;
        position:absolute;
        text-decoration:underline;
        top:0;
        width:100%;
      }

      .usa-banner .usa-banner-button:hover{
        background-color:transparent;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-accordion-button.usa-banner-button{
          padding-top:0;
          padding-left:0;
          display:inline;
          height:auto;
          margin-left:3px;
          position:relative;
          vertical-align:middle;
          width:auto;
        }
      }

      .usa-banner .usa-accordion-button.usa-banner-button:hover{
        color:#205493;
        text-decoration:underline;
      }

      .usa-banner .usa-accordion-button.usa-banner-button[aria-expanded=false]{
        background-image:none;
      }

      .usa-banner .usa-banner-button[aria-expanded=false]::after{
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-down-primary.png");
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-down-primary.svg");
        background-size:100%;
        content:'';
        display:inline-block;
        height:0.7rem;
        width:0.7rem;
        margin-left:0;
      }

      .usa-banner .usa-banner-button[aria-expanded=false]:hover::after{
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-down-primary-hover.png");
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-down-primary-hover.svg");
      }

      .usa-banner .usa-banner-button[aria-expanded=false]::after{
        background-position-y:1px;
      }

      .usa-banner .usa-banner-button[aria-expanded=true]{
        background-image:none;
        height:3.1rem;
      }

      .usa-banner .usa-banner-button[aria-expanded=true]::after{
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/close.png");
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/close.svg");
        background-size:100%;
        content:'';
        display:inline-block;
        height:0.9rem;
        width:0.9rem;
        margin-left:0;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-button[aria-expanded=true]{
          height:initial;
          padding:0;
          position:relative;
        }
        .usa-banner .usa-banner-button[aria-expanded=true]::after{
          background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-up-primary.png");
          background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-up-primary.svg");
          background-size:100%;
          content:'';
          display:inline-block;
          height:0.7rem;
          width:0.7rem;
          margin-left:0;
        }
        .usa-banner .usa-banner-button[aria-expanded=true]:hover::after{
          background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-up-primary-hover.png");
          background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-up-primary-hover.svg");
        }
        .usa-banner .usa-banner-button[aria-expanded=true]::after{
          background-position-y:1px;
        }
      }

      .usa-banner .usa-banner-button[aria-expanded=true]::after{
        position:absolute;
        right:1.0rem;
        top:1.15rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-button[aria-expanded=true]::after{
          position:static;
        }
      }

      .usa-banner .usa-banner-button[aria-expanded=true] .usa-banner-button-text{
        display:none;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-button[aria-expanded=true] .usa-banner-button-text{
          display:inline;
        }
      }

      .usa-banner .usa-accordion-button{
        background-color:transparent;
        border:0;
        border-radius:0;
        font-weight:400;
        margin:0;
        padding:0;
        text-align:left;
        -webkit-font-smoothing:auto;
        background-color:#f1f1f1;
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/minus.png");
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/minus.svg");
        background-position:right 2rem center;
        background-repeat:no-repeat;
        background-size:1.5rem;
        color:#212121;
        cursor:pointer;
        display:inline-block;
        font-family:"Source Sans Pro", "Helvetica Neue", "Helvetica", "Roboto", "Arial", sans-serif;
        font-weight:700;
        margin:0;
        padding:1.5rem 5.5rem 1.5rem 2rem;
        width:100%;
      }

      .usa-banner .usa-accordion-button:hover{
        background-color:transparent;
      }

      .usa-banner .usa-accordion-button:hover{
        /*background-color:#d6d7d9;*/
        color:#212121;
      }

      .usa-banner .usa-accordion-button h1,
      .usa-banner .usa-accordion-button h2,
      .usa-banner .usa-accordion-button h3,
      .usa-banner .usa-accordion-button h4,
      .usa-banner .usa-accordion-button h5,
      .usa-banner .usa-accordion-button h6{
        margin:0;
      }

      .usa-banner .usa-accordion-button[aria-expanded=false]{
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/plus.png");
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/plus.svg");
        background-repeat:no-repeat;
        background-size:1.5rem;
      }

      .usa-banner .usa-accordion-content.usa-banner-content{
        padding-right:1.5rem;
        padding-bottom:3px;
        padding-left:1.5rem;
        background-color:transparent;
        font-size:0.9375rem;
        padding-top:1.5rem;
        width:100%;
      }

      @media screen and (min-width: 600px){
        .usa-banner .usa-accordion-content.usa-banner-content{
          padding-bottom:2rem;
          padding-top:2rem;
        }
      }

      @media screen and (min-width: 951px){
        .usa-banner .usa-accordion-content.usa-banner-content{
          padding-right:1.2rem;
          padding-left:1.2rem;
        }
      }

      .usa-banner .usa-banner-content p:first-child{
        margin-top:1rem;
      }

      @media screen and (min-width: 600px){
        .usa-banner .usa-banner-content p:first-child{
          margin-top:0;
        }
      }

      .usa-banner .usa-accordion-bordered .usa-accordion-content{
        border-bottom:3px solid #f1f1f1;
        border-left:3px solid #f1f1f1;
        border-right:3px solid #f1f1f1;
      }

      .usa-banner .usa-accordion-content{
        background-color:#ffffff;
        overflow:auto;
        padding:1.5rem 2rem;
      }

      .usa-banner .usa-accordion-content > *:first-child{
        margin-top:0;
      }

      .usa-banner .usa-accordion-content > *:last-child{
        margin-bottom:0;
      }

      .usa-banner .usa-accordion-content:not([aria-hidden]){
        position:absolute;
        left:-999em;
      }

      .usa-banner .usa-accordion-content[aria-hidden=true]{
        display:none;
      }

      @media screen and (min-width: 600px){
        .usa-banner .usa-width-one-half{
          float:left;
          display:block;
          margin-right:4.82916%;
          width:47.58542%;
        }
        .usa-banner .usa-width-one-half:last-child{
          margin-right:0;
        }
      }

      @media screen and (min-width: 1201px){
        .usa-banner .usa-width-one-half{
          float:left;
          display:block;
          margin-right:2.35765%;
          width:48.82117%;
        }
        .usa-banner .usa-width-one-half:last-child{
          margin-right:0;
        }
      }

      .usa-banner .usa-width-one-half:first-child > :first-child {
        margin-top:0;
      }

      @media screen and (min-width: 600px){
        .usa-banner .usa-width-one-half > :first-child {
          margin-top:0;
        }
      }

      .usa-banner .usa-width-one-half:last-child > :last-child {
        margin-bottom:0;
      }

      @media screen and (min-width: 600px){
        .usa-banner .usa-width-one-half > :last-child {
          margin-bottom:0;
        }
      }

      .usa-banner .usa-media_block-img{
        float:left;
        margin-right:1rem;
      }

      .usa-banner .usa-banner-icon{
        width:2.4rem;
      }

      .usa-banner .usa-media_block-body{
        overflow:hidden;
      }

      .usa-banner strong{
        font-weight:bold;
      }

      /* USWDS */
      .usa-list{
        margin-bottom:1em;
        margin-top:1em;
        line-height:1.5;
        padding-left:3ch;
      }
      .usa-list:last-child{
        margin-bottom:0;
      }

      .usa-list li{
        margin-bottom:0.25em;
        max-width:68ex;
      }
      .usa-list li:last-child{
        margin-bottom:0;
      }

      .usa-list--unstyled{
        margin-bottom:0;
        margin-top:0;
        list-style-type:none;
        padding-left:0;
      }
      .usa-list--unstyled > li{
        margin-bottom:0;
        max-width:unset;
      }

      .usa-prose .usa-list--unstyled{
        margin-bottom:0;
        margin-top:0;
        list-style-type:none;
        padding-left:0;
      }
      .usa-prose .usa-list--unstyled > li{
        margin-bottom:0;
        max-width:unset;
      }

      .margin-bottom-3 {
        margin-bottom:1.5rem;
      }
      .margin-bottom-6{
        margin-bottom:3rem;
      }
      @media (min-width: 480px) {
        .mobile\:margin-bottom-3 {
          margin-bottom:1.5rem;
        }
        .mobile\:margin-bottom-6 {
          margin-bottom:3rem;
        }
      }

      .usa-sr-only{
        position:absolute;
        left:-999em;
      }

      .grid-container{
        padding-left: 15px;
        padding-right: 15px;
        margin-left:auto;
        margin-right:auto;
        max-width:980px;
      }

      .grid-row{
        display:-webkit-box;
        display:-ms-flexbox;
        display:flex;
        -ms-flex-wrap:wrap;
            flex-wrap:wrap;
      }
      .display-block {
        display: block;
      }

      .display-inline {
        display: inline;
      }

      .display-flex{
        display:-webkit-box;
        display:-ms-flexbox;
        display:flex;
      }

      .flex-justify{
        -webkit-box-pack: justify;
        -ms-flex-pack: justify;
        justify-content: space-between;
      }

      .flex-fill{
        -webkit-box-flex:1;
            -ms-flex:1 0 0px;
                flex:1 0 0;
      }
      .flex-auto{
        -webkit-box-flex:0;
            -ms-flex:0 0 auto;
                flex:0 0 auto;
      }

      @media all and (min-width: 640px){
        .mobile\:display-block {
          display: block;
        }
        .mobile\:display-inline {
          display: inline;
        }
        .mobile\:display-flex{
          display:-webkit-box;
          display:-ms-flexbox;
          display:flex;
        }
      }

      @media all and (min-width: 992px){
        .tablet\:display-block {
          display: block;
        }
        .tablet\:display-inline {
          display: inline;
        }
        .tablet\:display-flex{
          display:-webkit-box;
          display:-ms-flexbox;
          display:flex;
        }
      }

      .usa-button{
        font-family: "Roboto", "Helvetica Neue", Arial, Tahoma;
        font-size:1.06rem;
        line-height:0.9;
        -moz-osx-font-smoothing:grayscale;
        -webkit-font-smoothing:antialiased;
        -webkit-appearance:none;
          -moz-appearance:none;
                appearance:none;
        background-color:#0071bc;
        border:0;
        border-radius:0.25rem;
        color:white;
        cursor:pointer;
        font-weight:bold;
        margin-right:0.5rem;
        padding:0.75rem 1.25rem;
        text-align:center;
        text-decoration:none;
        width:100%;
      }
      @media all and (min-width: 384px){
        .usa-button{
          width:auto;
        }
      }
      .usa-button:visited{
        color:white;
      }
      .usa-button:active, .usa-button.usa-button--active{
        background-color:#0071bc;
        color:white;
      }
      .usa-button:not([disabled]):focus, .usa-button:not([disabled]).usa-focus{
        outline-offset:0.25rem;
      }
      .usa-button:disabled{
        -moz-osx-font-smoothing:grayscale;
        -webkit-font-smoothing:antialiased;
        background-color:#c9c9c9;
        color:white;
        pointer-events:none;
      }
      .usa-button:disabled:hover, .usa-button:disabled.usa-button--hover, .usa-button:disabled:active, .usa-button:disabled.usa-button--active, .usa-button:disabled:focus, .usa-button:disabled.usa-focus{
        background-color:#c9c9c9;
        border:0;
        -webkit-box-shadow:none;
                box-shadow:none;
      }
      .usa-search{
        font-family: "Roboto", "Helvetica Neue", Arial, Tahoma;
        font-size:1.06rem;
        line-height:1.5;
        position:relative;
      }
      .usa-search::after{
        clear:both;
        content:"";
        display:block;
      }
      .usa-search[role=search], .usa-search[role=search] > div,
      .usa-search [role=search]{
        display:-webkit-box;
        display:-ms-flexbox;
        display:flex;
      }
      .usa-search [type=submit]{
        background-image: url("data:image/svg+xml,%3Csvg xmlns='http://www.w3.org/2000/svg' width='65' height='64' viewBox='0 0 65 64'%3E%3Ctitle%3Esearch%3C/title%3E%3Cpath fill='%23FFF' d='M62.672 55.618L49.48 42.426c3.18-4.59 4.77-9.706 4.77-15.347 0-3.666-.713-7.173-2.137-10.519-1.423-3.347-3.347-6.231-5.77-8.656-2.422-2.425-5.307-4.346-8.652-5.769A26.606 26.606 0 0 0 27.17 0a26.61 26.61 0 0 0-10.52 2.135c-3.347 1.423-6.231 3.346-8.654 5.769-2.423 2.424-4.346 5.309-5.769 8.655A26.6 26.6 0 0 0 .092 27.077c0 3.667.712 7.172 2.135 10.52 1.423 3.345 3.346 6.23 5.769 8.652 2.424 2.424 5.308 4.347 8.655 5.77a26.606 26.606 0 0 0 10.519 2.135c5.641 0 10.757-1.591 15.347-4.77l13.191 13.153c.923.974 2.076 1.462 3.462 1.462 1.333 0 2.487-.487 3.46-1.462.975-.974 1.462-2.128 1.462-3.461 0-1.358-.473-2.513-1.422-3.46l.002.002zM39.345 39.252c-3.372 3.372-7.429 5.057-12.173 5.057s-8.801-1.685-12.173-5.057c-3.373-3.372-5.058-7.43-5.058-12.174 0-4.743 1.686-8.8 5.058-12.172 3.371-3.372 7.43-5.058 12.173-5.058s8.8 1.686 12.173 5.058c3.372 3.371 5.059 7.43 5.059 12.173 0 4.744-1.687 8.803-5.059 12.175v-.002z'/%3E%3C/svg%3E"), -webkit-gradient(linear, left top, left bottom, from(transparent), to(transparent));
        background-image: url("data:image/svg+xml,%3Csvg xmlns='http://www.w3.org/2000/svg' width='65' height='64' viewBox='0 0 65 64'%3E%3Ctitle%3Esearch%3C/title%3E%3Cpath fill='%23FFF' d='M62.672 55.618L49.48 42.426c3.18-4.59 4.77-9.706 4.77-15.347 0-3.666-.713-7.173-2.137-10.519-1.423-3.347-3.347-6.231-5.77-8.656-2.422-2.425-5.307-4.346-8.652-5.769A26.606 26.606 0 0 0 27.17 0a26.61 26.61 0 0 0-10.52 2.135c-3.347 1.423-6.231 3.346-8.654 5.769-2.423 2.424-4.346 5.309-5.769 8.655A26.6 26.6 0 0 0 .092 27.077c0 3.667.712 7.172 2.135 10.52 1.423 3.345 3.346 6.23 5.769 8.652 2.424 2.424 5.308 4.347 8.655 5.77a26.606 26.606 0 0 0 10.519 2.135c5.641 0 10.757-1.591 15.347-4.77l13.191 13.153c.923.974 2.076 1.462 3.462 1.462 1.333 0 2.487-.487 3.46-1.462.975-.974 1.462-2.128 1.462-3.461 0-1.358-.473-2.513-1.422-3.46l.002.002zM39.345 39.252c-3.372 3.372-7.429 5.057-12.173 5.057s-8.801-1.685-12.173-5.057c-3.373-3.372-5.058-7.43-5.058-12.174 0-4.743 1.686-8.8 5.058-12.172 3.371-3.372 7.43-5.058 12.173-5.058s8.8 1.686 12.173 5.058c3.372 3.371 5.059 7.43 5.059 12.173 0 4.744-1.687 8.803-5.059 12.175v-.002z'/%3E%3C/svg%3E"), linear-gradient(transparent, transparent);
        background-repeat:no-repeat;
        background-position:center center;
        background-size:1rem;
        border-bottom-left-radius:0;
        border-top-left-radius:0;
        height:2rem;
        margin:0;
        padding:0;
        width:3rem;
      }
      @media all and (min-width: 480px){
        .usa-search [type=submit]{
          padding-left:1rem;
          padding-right:1rem;
          background-image:none;
          width:auto;
        }
      }

      input[type=search]{
        -webkit-box-sizing:border-box;
                box-sizing:border-box;
        -webkit-appearance:none;
          -moz-appearance:none;
                appearance:none;
      }

      [type=search],
      .usa-search__input{
        padding-bottom:0;
        padding-top:0;
        border-bottom-right-radius:0;
        border-right:none;
        border-top-right-radius:0;
        -webkit-box-sizing:border-box;
                box-sizing:border-box;
        float:left;
        font-size:1rem;
        height:2rem;
        margin:0;
      }

      .usa-search .usa-button__reset {
        background: white;
        display: none;
        margin: 0;
        padding: 0;
        width: 41px;
      }

      .usa-search .usa-button__reset:hover,
      .usa-search .usa-button__reset:active {
        background-color: white;
      }


      .usa-search__submit-text{
        position:absolute;
        left:-999em;
      }
      @media all and (min-width: 480px){
        .usa-search__submit-text{
          position:static;
        }
      }

      /* FONT FACE - Roboto */
      /* latin */
      @font-face {
        font-family: 'Roboto';
        font-weight: 400;
        font-style: normal;
        font-display: auto;
        src: local('Roboto'), local('Roboto-Regular'),
          url('data:application/font-woff2;charset=utf-8;base64,d09GMgABAAAAAD8UABIAAAAAkDgAAD6tAAEAAAAAAAAAAAAAAAAAAAAAAAAAAAAAP0ZGVE0cGkIbmjgchBYGYACEEghUCYM8EQwKgdo8gcJOC4NyAAE2AiQDh0AEIAWFFweGfAyCSRsdgRVsm1YzOA9AqOLmUDjhjoeNA48R3rWMDAQbByA9yMz+/5bcGANu0OoLVgkiKgibLUwmC7PZaAfW069bVrtCnvyhf96rUZyIA+vlhqnQlMFLNfy6PeLzw82/ZQZ17xOVFHmh0uVz6zaM3cYyTVxEzOhSZ2DbyJ/k5OX5qI7+OxGZWdXPA8hrkcu/GsE7AH2HaG73K0aPDYkcIFhkxhhjdA1GZMqkN4MoQQVEwCi0sdPv1VliW7bjTBxSlKyD8PcIu+37q7C6Cjvg1wOPFlP9zDlQaWmLeCiQFJ+v1jTg/l/ouMgYnbR6765EwqPq+DpVowh2OQRHOq0ZWTLMaK17IKi5vaseaLUr27lL2En0wIJpVnEnJUXzBEV7339HpWQH/tl/vPSPJLdG58IpVrEnkGMKQsFnvIfLtJE0amVrt2/PTq+IBcAA+oAFwCBoAA1gAHz/c7oiHJKjLfwc2BwenZS5/mcu4XE7Tr26Ih3GYNJp8h0bfK0TiNbGthI+F6n4bE1YGFlw6q4qbpyChsz//7XUzt07sxR8CcufslzhCiSnPXGNEosnmf2ZAs9uiSaIqsCkyq6SSVVG1piqyipr6lNr1qur6kmO0QG7OyFJqDPyhOp53ZOZdE+SCS1gaClZnOQIkhxk9+gjOlTgPicfiSSwkMhCSEYh1ff/X9WyfRcYcofUcKX/NxdVCkX3CWyQjrYMdlVST6Q+BqCCCThJG1KsPA9/AvExCaIj3dAhhDbHpnDTblHucdFWhv7d6dsBfsEDoBYGVguCgOIsxqYHTy0KsRk8MeenP7XvLJGx5tWcwEFm5uOny8Tp+vM3CwkrRves7U3BGwFC8oggIWu/J/tj+j29OevdbveHihMQAgED2J9CAXz3nRdFA8Bn/sR1GfVnlePfAASGA3AhwKXAwEEegzzxHMwL30EQgAYUGOA44HQgQIGkgQBHOQuEuNFNrJ2BwANTyAQg9VBySBRQfFRAPBHoQgD3n73f9KxHPphMBOggpRQCDOjNMm8CGu/ljf3NNOvUqd+cS66649CrGq0Jd2qulupWvWq2Pk/Ld2STuqQrgXdGScwQGqeH8bC80N+loPKqw6nuLKDluyQ8jJNRbx2pOvF7Ieq5BeKFFYImblqwdPDoxAOCCx6cRJa55z2vPATHnucM8kVA4kGKjQ9jmXeV4a/Iw4QH1n+fZFzJHv6gjptJHjDLa+YDLGAFJ7j4rnnO45TvmZd8oPLiKh8FKEQRKKonD/SiD/0YwKAazmsjGMUYzmIaM5jFHOjqQl65iEuYVwt5aSl2Na9dD489HLRCvLLY+NVeMO44FKcDknr2aeYprbyhk/s64SAY0Jy3CXbGdgcaIre4ZppX1hEP52TmpOLYGEq58+mCwI6bAa6O1scC4ABOsOF1bw4cWPK4936ObDOAZZlXXHOL+5zk/ywxZ2XmmuJ0Gsqi81mwnxsmD38GRTbvaHi0og3t6PgcZCc0vFAwWGHM6I5llpfMAQtYwSUZhTM8OyMCoxjDWayqNRjb2MEubuAmbk3JyixvmMMCVnDBMEYwijGcxer74SxxcqfICxcUp9SZBmYwiznQnw+xxA4Jk3zYAdexh4P4CchCA61oQzs6urOyhmcH2Pd2Sja3VBZ0Z3p3ZgRmMQf6fxHEHAIKKzY4kk446ZTT5MhTokyFKnWatOjQpceCJWt2HDhy4sqdJy8+/OTJV6BQEYoSVKXKlKtRp16DRk06jRg15qwp02bMmkO3YMmabTt23XDTLbD9XxDAut3WSwifZsEZjMuTPFVfp7cirxdrn2W/UfkqR03NpgjwvwL5EpJ43VbeJyvdgOMXQLn3eSBD8os+rtwP0MlR7pvhqdK42/x2tizvGw/rOeBMQof+eHDkF7mH+qqVtOyRfqRDfz449KeLjUK7F9GnAtTtEkf/KnF9n+dRjvIsE880t1h6gfz5PMmtMBa3053ZvEknLtis5XE+YAfIEa7IwOYq3x2kLU9Tg6935VwqMgc4HUxKs5K5/iTOSKWtfMEAjYzae9ObXpsU5d5iL5Z7m1T9gqtfY+YeXcnJ7Gof+RPpA97M9t70A99qzP8WbOB0J6WgKKTVE5OYrzhl9KOibYgefuRso96Y/lc9T6V7cE9JWjYP34YL4cPTwoldEQeVXTU8kuX1lGzpB2iNhXJn8zJGtr7Nfh7SDE5GUnDIlV6jCNeew21UuC+Peg8WfzdPMx2O5Cu5I3o7+ruqOdj10m/qUG/hxSq8MCIIK4IkBUZK+J0QLicFckqQZIWFnLCSFx5KAlEWburCTkNYaIoALeGjLRg6wkZXOJkIiqkwMZNjLATNWiPciIfgBIFzFiauguMpzLwFy0eY+cZyyEMBUxLLhaocUs3LIXWaQFp1YPHyhrPpMQhlGLHHjDgLbSoWYRod3IIwWxQmS8JsTfO6IY/XdWhBd+Tx2oMIOtCCzmkRL5zkIpfHjUtkeUAtwK1RkQdzRgiMrPBSEhgVgVHLckBYgIXMPEYcOclKTBI83wLESmgINsKJ8OBcIBA3YeORRUI4NzTRHjsSNA+QRGkYeL1hWrSAxWQmK5jiIER4HOMumIfU6NBDW3kLzKpA1npzuWYLD5zkIje5yE1ucJGPgJCGAQn4z52CIE0ZM3W6sEyY4TchCkE470zEbCgOibyv48LhxOgmMlp10hGFhjDP09l4INqJ29e72rbHzYFbfN4zzXvWP56mZsgS+q4KUva5spiufw8TPNC+oaNzKL2Jo0GN5a3trGtlb2PgKnews/Hu5GhVSRHRXAiDzFhw2oWwPx3/2Ac9JiYaSP0PPqOA9KMiwgKAavx63UfFBBGA8WMSosnAkoNWYID7fXmgiReBmODjKEww+OCdJE+dfuXaot67q30sdwWVk6DK4kFFGjGlUHhB6gqI0Gg0GBQOzzzh3jaegLFpnJ4ln4u9p5Z9khUvr8WB37pYrvUSxOMmbAwqPeKuu9W/9EGw11sAiyMvvfDKa2+89c57H65H82v5UboEiT757IuvvvkenPmYZ69KSGC9fikBdd5janxTaOO7DvfYU4GLAm4JOB/ATW9rZwb0gfzdwD/gIXtzAzzoLQDzGosGOB84cA+hgORxEZH9MobwAXA1eAh8gBMy/Yc25dQXeq3v9L3zwfBH8MfwZ8IL4EXw4ngpvBJeE2+Mj8ePiomLY//9//83/4HACXidpVCORFPOiOfDCy1cEa/xmY3MtzzNcqpDPmT5V3//8H9d3h5ePlw6XDxkHM4ezhxOHtIO+w47DxsOww8VHl54cA16BJ4CCBzqEQVwByBsXr0lEQAfiWL6uNT1wanrK5S/QcTEJY5LSp04eer0GWkZWTl5BUUlZRVVNXUNTS1tHV09fQNDI2MTUzNzC0sraxtbO3sHRydnF1c3dw9PL28fXz//gEBQRCkprW3q6O3pG+gfHB4dGTtLGz83MTUzPUufu3jh0jwpIO7BoZH7Kd2xhAdJUaD4DSAeeNhjAcCjnwSGPpwbHAMAj3nyQVBeYePK6rWt3RvbOwxL7v709h0APP6be6DgRfnl1Mqq6or6BlD3pvbW5fUNMgBfeAIAXEKbbCWS7Qlmy1MRf66UW9sFE8qtAM506A+4uwV+iGGd18A9y2AWDffG51j149oWcGw/hAI4zcphhWDimLlcEv4f7mEcWH5LDQaRvRjwo6EA7pWGBYpgVVGfC0IudePepRGdN3vY1VHNXqKDu0sEWvlCoI0VRPzUfhApa9g0nLblboTpiu28qjTTX3PQOH6r7nKPoY0PMbKTUmRhvpthjK+elHwuf+pcc7tkOCWe5fZk+sTGQBtCCbrdm4kUFLRu8l0hz/Mwe5kwJXNJBFZlTVB3Kw09Cj+md2os8T/HYzQCNAZszaG/kuYQaK0kkdLdYjHiJvUmt/JXPLRLfHoDf6mF/0jioxgw0veX9ooQMJIAcl2WkAHPu507BYzPyZJTxo00W8fa0GD570k7/nXa9SfAP4ETvwDO/AwARty/n9t0pYcBZCj7ddEhSHBQIeyowAScPRV6AaEJz+QL+8AWFFJgyvZnA3TtqREC+CA+WPxMOsR6KP4wLAd7dmTcRRZcVDdBt+emSSP0CMBdOJCbB2QYyR5s0V5Ha4ZWjlWQPHSuHa3/D1BzPuLT4F3ARTue59FpNBiCbE+Lc+Vla0zrJaLs9HuvWFR6csaZ1WFyIpo8WF37qE9VyMJpo1BJxMVEOydbq7q3OWpvPM55cskmG846k94l02HXot73MTaI75LWY4yjETHVGp112JxYWBOlD51JLAXXah30kydWzQGNqZVOFlu3uRWdRQRaHd5PgpR44xVih4g1Nle8a2Qwp8WxdLK0pnBZkBAkymX/cJiuRYeYjudUcl79N7/up/6ThGa8+cP/UahaCNUs1AM5GcVAfrrGnLpUbJaMlVhk6Ago7ko1gqN/bReHGghLBosINyIdUW4IcimqGeM7C7FZJaPIyxPU7RiBSfOGkXhWkbaDIDcUK/XuSp8OxGRapHq52ZS95/rLKF2yK8Fiw7/j16u4sHGriT467JJe5vNbp6farGKGlZ8b29mZbNnNKSfb8cZETxMjCkKPeiGqHk/MmCodZkdhJSMgOfWYhOVIqfYpLoIb62HdBbXH9cnaiEYb+B7fdIlTTuJA1SptudmJhBm5QLowTFKh46WUcP15NSQM5FFvjMK5Cp5eX49gnPQSW1ypZsNdu1OgGl4WoBZ1wzJbxMVue63+9gI1S3KVuIQ3SEdc/uvKVORTwK6T5dTRWW0HsKwWVJfx4Gi9QciH9q1GLKrYnr4DJQqwFT7rZT7EAnKcry4+K/aglXSAbluJfqVapTozp00iaqvitRa4E7jYhvX8VLf2b1T1Wvy7cpvPZxfx/zW+OMtbcKtum/06vcZYPUvhgj5V11iUFKN06CubWDRbCpxlQmnndLzt7aBRdBPTkqlWAGeMgHkZF2cxOP1Hl0NuArFyI2M/gktyA4y9SJp0o/4FvEw0uNgpCuu8od5J5K1eiLUABdfZ2I8CViYS4iHMXKkTbKY9u5/xxwVts65iKfjvEqznVF49FRMqhwIZIxt22o9ZjbwZzMLp6dSVYdNOI8o1gJuTiMTQ/sOkN/VWSzLpJGwWOtQSqA+APr0XmZLV3twWjAFoT9CICxIWJCHeJP12rS/XWzPgfvlp4eA94ZxKnsdWuBiRCRidvxyS8v4BHe5TeshZyrlPQcnbN8CNaDIrglDBEIqSwsyiihBZ7AmlfECFOWXQHt/wWdbXuhVzKqskFXsugT766dgGxEVCSzi+ejZvVlICEu9Ns2iNDVrAyHioYITWq3DJFHBBnZi+AgVK70a8M5dcFiDHNneGNm4fatQRLpkHhGxB1Xv6OqUEA/VvPVbxIWOXMzAtsGglWdUnhz4FAzgF3SdhRSOe2od9eNTU+/gjnnvEmJzIuf6k9+2cdw7IvCLxqm68RslZ4UQpBn0aNWT3EBytixHfADhJaIstR1x2ig+KrkeHr40HmrouOI4gJNf7YRhWX8jz35qS04wIKuzobOIxkE8hOAS1pgWE3BOoIgH7DhllwEPaNigpv3BPikA6M6WB06T/XIqeVs8YvNKItSXPqPOBMsYb4IMlI1YVNm1cKatEBxx0LThLu2OLHmNVikUX2XYUg6uhbs0HKTE3Can5t3dXHmkE1zUT0GNquBnxrc1yvMvY+rKeX8c0dhDpG5F/EouGkKdQVE0UCBnJ2lhYVQlMfRRCr5EUqdJR12wcSEQ7d5oUhOCW3OhP+pAnA+4PKGBxYKUWG+W0EjdlsNXmdMECIbS6d2tmeyGf78QrOufdPnEQesBJNIFx0Xed/XuyusDK/6OlevEq/j9ZnMFyVZN91ZupDgEyDQX1ohJ5Ct2KR8e2Ezes4wWsW/TXYRrf9GiwrlMiqdQA6Kun6jIbXt20kowx8ik48sZavCNHThxLSDQb47zg+Vs35Ikz6tBKuKnQXbHGSA+BjJ1nrd+RQQozcSt4JFFA9RLaelWs7w6C6n5SYYhKfBmbUqBxm4eYf4dTqbP2FdJ3F0PcwobNU8xoCaSakkvTcbIBFZlEML4aleoaW0tB4LYq18lTDquuRWfzPbs7j3d29d7ONgJNIyS6KZ4IJw9zl8QJ2nRR5bzDtMS7czPKDD2Sia9u6hSNYIG+aOnoF+wvTMu41A/aKY5zO/EFnMh4+ewNA8qL9Jz5lh4ESFZSGOCBzjrgfI5gWs4Pat2drc4f/JkVlxLchu9Difv6Z6xtmnCyk7JRJ49dSn9dyeNV3v8FV1/m5uljCQ7IJQ6S56ZXRcIc/xow9qO8KSNPj/fCR9WXZLx65VlW9fGtAmQ04YznFtWU5EYbjlCS8ba8XtU/Mgu9dpzKeKWhiZQdaT206Jnqp75xDi/7EqW7tIdzll3YofmeNRJLyGVgO926VG9d7EQwaaHYMnM6ktDUo4AnM/Zpbx9aTaj2j0sWeVlULze/drzm7//J7zlCixAT8BoDlQzkFMFSD0UEq3rkSFKzstqby4K20Z4V7lGkQdi/iUZ8nUYji/E+CPuRzZvKIs2PXLOJ2imMuxTgdLbBfEW4aB8xEBCGJuUd7j0+mykIdVu2Q9cRUOE/5QI977akxsdB7Stn+5SGGGWuC3Gs+56XNlBvgoo3Mq1/wP02/9XfnIHG82xwdHEZGzG6T35nPt6fjhWApK3AQ7wBkokr1yTxPWvSky445EOBfOCxns0DYO/YEludkwyBkO6ZSoiU53JJFg6JAW9L2YuOnfn/NKHtmio+x/e+mNk4AEYVduioGAiaVC5zlfrCOOBR8e9CpLJNHK0eo+gqlZwk7+yMRsU9/aWdrt5L1/txd+vuDfAwXl+bKyvoIydlpBJD85PlA4cT7dsihzavzWDna+fpmN3na3RqVV1hXl1GBKq2Ma9/KK+gd5hilt/fn5M71E8tRtm6BVuauQa4WNi6hNS6hDhKTMrl9Q+iBgaoZlIgmgcg7X4EmbsEuljauQZZmLkHOv/4FG4gHU8ON0gPLoyIH++N908wqDDrXz4/WL98tsDdvZboEGlrlGuU0zHwvxzY/vHAn2xhsGYctg89OrCsSYkJHGTqT81NbCyDSTzzT6hIcDSSU3DVNQpyt3b0IxZx7ldxx+SAB3WYfNvHyR3vnbJNJFOqYhhX0ELAObdU0Hko3k+SlG+RPPbaiVnV+GF84wePPHMpUlMC4wMki991C28VDrCTIuWZv3NJbGHm7rkp4yFTLxODdmti9j4ZLdOg6LnKkeZDF53kS/fEn3rCXj9ef5VxNfwJNMQQLBALN/PJhZcMTFeFBG7wsYm8bHiJrfCXryCPy8uOkcuEaOkdUiiZdpx+d7TJfa03Rw+V4YrfDe6rvX19XxqmMcf2Ou+gojxnH7p/8g3lkFqcfwP2ROs243o8ZZBrTVhTiVHwXS4m07ndhVxcFVfS2FpK34B9v33l9d65m1wnC/rv2vEFKVJzoboCMvifl1Ni6WN/ni5vHd1e8ks9F3EmSTJ3PGvl/6YZ3J9hxNUVZxaWUfOyWoqqIWqaesDRZsOmI8OxIfrk8sfVE5/XVzfdLK/dtth/NWJzpjRSl7J+hDp89Al2Z/HzPubCOCa9IjMxp3q8pbqdlp9irMwUrPz1XJv4Tfj/78UhOW/90mPWvUdf2Leuw/X/mlW7Djoirlf4dcSKuBhPdd1NySifrauvnHMwdDGXnDZfkqzj4268paS7ohxNHgqQi5XPP5908d/Dnd0/hxcSsy/GyvvLxQwR5l7fXFx4c5M5zi+1uelXfcOP6rK83JpyrmCB6MLC+Jh8ygP7XVNMDVZ6nK1h3Onkn8lICzmkVBOPrqRRbv0w5FUdsit0RBxvPfEU/vU510+f1lgJJ8uZticpqTWMprryBS8Mhikv9s+KklhatZJY6gqPTo+sYZehvmGn4QmFiZJa2CWVgNRqlYC0BZ7gJihRodjaKbfQyTc6IjoxIjQtyosOdT1em7m4u3luvGuIEGVu37igPXt/AjkRur6xfrzJO31eeUDFucTRsrzqBfYqR28y7FJNhEPWaTtdpVPY5zWx1IfISWy+aYPthtraZBLLV9bvFQSpheueU2cmjpMPripE/Ao7nOhnFWDF3p9Je/f+Z9DDsT79RyT2MvsGd21iiIQvWuZbun5C41uC9vX0QEramvgqbVB8n7Y6wf/++6DzEEDS7r19t7wQGtcadDoBT5nLXvn78KX6IJtOYXNJKpOIXpN4Zn0GIZlKqBByt8nZEngu8usdTDVWtfRKpRJz7/hLXhjP00W+sf6W+rkdzt9lb1d5JzqHKwUnzegeT8sliYF2FXDZZ0s+QaX6liF2FWzC5oNvuP8uP15i9yEtXVhXEuJ+WxtA0mrab+wlOWgv5QXlLQAkrbB97VOQoc3CvEUEOpw2geuvV4I2sywUI3ieHnspsr+gghdfXOMAIPv6ED9P6JIzN3NoxRDss8Fi14OuBYCkLZAfkBfDkn5fQWH5adoi0/Vfr6/f/nj/8kIGhZqbVF0HCuUEes/Nvak/zZ3C7ZfauVI9Ms/jI1on2uLS5RZPCRyjCa/0fsTPqLgaV5Dw05Ya4b1GrL8ahvDoKimzFxi4eOXtKvMlLGze2r566KBCl2mANso8WK0OXYvYrTJgGR4dZxms0N+/BMG3uc/P7HDDvkb93hWhM65wwP5ohWtoMnrT4H/P8XljD/30u2urR3NPZXFuT0s5LNjOHjt0o0A+2QV+JTdZ8bMZlz3VChrLkFxpfx5AV3kuTYexXzui8Shpd8na1YarHzOPv6EfHlCqN3IVXCLYtqqOTlQM1qQXdVY0AKkgF8o308OtxlHs4b36V3HZV1IW8wfqm8rb02M86lMjQ66mBvbEnMPtvaiHk0vXsxbzlxp7GrvSDurigy0SsHsAiZ0HSOyN9lA5yz7aA3ANIO9yir0XhKBHh5futI+d7eoZHWu/q1PyTwBxbldslTYsNk27rv54U3D+5CgW/qObq+bHiXGRZQ6Jp4s8x2jj2BVJHiIPERcvOc6DpC14nDTK9ZZ5fOX6wf2nIWphak9u3r96/VFU8F7anTuiQVWiC6Lhr8Z7CuqtBm3HKxWe5nK1fy8zxU+/nAcoynxjCmCaSzkOK6DRpFAyNByoz04FTHOpjYsARVk8IdB7/uKj0dMHWacORk5oZDfUNtQKCffe6YAkH0qc/M/skF0w2Xl1ijoEGEdTLgFx5NiggiAzhgO5fsUt8fwNBrznU52kG+ZLqVuLh7jZgyrndbe4gHRDGNePJ9IL12Iq0enDAAXoOjElJYen4HOIi1XXimfthvach6YKaq6F6uQG1SQxeYwjvBMGVoKI9xFSQLQ97uutotqZD7eZxsaZwssLI8qaNxckzjdtWPlK/nwtO3+JmKNMBygwjI4jFq1deKP0Yw4117BdSLNv++jYOEppuB5qjbuHw38S70r9c68858bRMbjNfXjHxEpJYJGdogHJrWgHG7dJaujmqhbhYCotaia8GBmpGIk5S784rH/IXPdSxTMgPJD8ouLFSIif5N+j04trRCo6aQi/++PjbsLDIE1XP2Ji9WhRfUOJDzFr4dIrBfqn2bqdonGH9nfOzcNFDdcLuZ1mU+tX3WC5V+hXQXx4TIxnkZ+kDZwOUIBu6ULXpK+LyEQTMjzTCFF63FOas+qCOgq135V19Q2dzmNFpIkqqtXpXlb0L3HJ6QSluwIT7YMe9S7vJ9xOcCl8JAjjejURSYnUzScOYyo2o36JwcjkffpmfAQ5I6wolSVsi7H65sWMYTMPXTMZN6WJLEpruczNf7Cazp5SHel/HxRX3Mco/GNvT/51SK2+h1H4Q0dP9d8uLeu7tz4xeK+0eOC2icFjru+PZBZXSenMdIC8M4ROIlE3lh9Loubgsy03KINOtUjHmpGC1l2Sr+T/o5OrC8RsJsIwQN6hI2KSGCsv5f/MMTFabxT0uVZh3cq7C9v2ok/F1dYrzOg3A7rmFCzds3JA9aKZvJioFcmRT6vXyTbOvuBwdnzu6cVahnV2dGBIrJuZUYQRt86Ii2OyW9WLs/TcdS9Srz8d4V1CIEdkOgfzJeijNis2OwxU9A3wafXmOJP0jLqSjtWKVVSAYnZUVOb1sanLYGWBfv7b5T2TNhxdk+b84RdmWe8in7FmGV++5kV1487/Cq5Fx01p1mPilDFw5Xpcr+Ycu9NpzuXTdf7fzr4vuRXAQxA/+Fn7s/YmQTyA58DpLQfn8pk1QeVHwez3xI3Z6nG+4VZiwSej+Y7Lblpq1Kc0eFEknfitm5TzTJOiaQoTTy+sf96r2vu0A82cPZxQlCTvGApsPul37/d4tgXDXjNQNGKvA6hLdTjsr019FPO9F1NOUw5HVwR2DCXJNIVzh2Bu9/1e1d7nzQtTj84qKNp+Zm5n3Co2z1IerLGQOG3rFOnbCXXOXqNaU/XGO38uWvvG+RkPjQyCPe4ltjprrXuDKFnkBtckM7mPIzNWL1fwH9FfTYitC96T2NsQouEf0x/W8czfQNbZ32OwecN5IZrpbrOO533Qim6zSVbIhfzQTPf62jrR8PUvby9fun/j3HxUZlpMRE5TBhqu15Zl/IHUnnd9uz2noCinsKQ0rGVzK6a7uj6nqLquLWl5pT25tiGPUt8U3X1lJaS9vCKvSBOWlka+sZzyeDmVtJvmvwJXkkmxy0nkGwZik/xK9fvEbWSGcZ9xurHhoqFuum6fbgYTcftWbDU7L4P3MuMbg8+savwi3dlY3qwoeBC+9pR0Wc1EvYR0jQ7lTta3Uvri/T3Kwnd0puXmid7NMYxpNwN506Lgfpb1By/hj67RMwaaqeWd5EATNbtCfRG7QTOSv0a2yLAHr6WAHdYy2MRUxS7fQNCBZoNzCjZxLyHko1y89jGQZtnYabn+X0HE5JNL02hne9uF3Rki7dJuS+dIT111kK+zl29UcVpsclSxr7e3U8i/vNGO49g+fa6+juOjw21i2P6uTlxvuwR5aJPhYbmWbbHG8NhcnXSz3FlbtdyadmuKWDjnYuWSnZSTFhbTnzRKUC5KN7FVUepkDRvJKS5oKi/UDuC390o943aCUU5yBO66Sr4xWo+SGOiCLj1Bj1sMg+Q1Dk6qsws32Co2OtKKxyU/gea/OJY5cDcN5makZemnKIAmHVckpuoGHc/pR4aPZ7WaQW4GqhY22sElY4rPeDorOvnRxxfCa1siw6ubIyKr68Ij6ur+HVO1MNXQtLBUVbO0JVhaKJyscSU0ENoH2nMactoGuLk/GzUamQ83uxHO8BNCTBT+aFuZWmm0kftr0E2ZxPDISCfb8coKV0xtqLOlmba8zJGphqXiqbbA7tT04pbkcDUTTwO+2pMVkUPplPy+jKh2GVstI1NzLaXYFsi9FLcGDlkl6ySOKWumgO7Qlvh1nQY8Q3MATfYuHK6xN99fwi6IQyHa+Tn678E+87/n7ABJO1N96x3J41juLLmcV3iyUaA6oINUgYq0c1WSk/4ZgBYtMHzX3OZxUz07MB5rwNQb1H5+qbnl/EK/ZQdjUfniYl83Mtg/1tnJlxxiG+Qf6+TgFw35G2IwGKsBEHEy0y9hdoElkDs6jhwdnE7yokOdh1dmV/YvT451nCWQDGyqF7QNyC8jrfwe3K/Lz8ubQAJxHP7KV/0fqyFps42TuAPbBvNj2EUXruTLIvfSmpEezvXmhYaFLC9z4smmP3834lzgB5LU4aM/EdwsT8jd3MLOzDYx1dzWPNCVRlRYlvZvn/q+7URHch38m8srnl+cD3fysC7wQU16aG9Z+z8KA5LU0Q/6ElAqYUQJIfbv40oq2LPPqOWKO8V66qV4czJ8WA92HiRNkrfmbnjiYuYS0/MnWA0GQNLoF8SPlXfUJ6d11BcBD2O6287WK8bUykRHRtamiZKl7/kKlyLrjs1zMw5TZ7xON3MWnlGJIvk4Klv4Xah2LXbwKNly9g2LdL8jGQXPw932kBtZNKnv8sinbOD8aEPb47H7D12iolPDI6jRDrPYio9T5+PGHRUcdW3HXCN2X4CjuFuo8bFLdbXJVu/0itqS9Uj15m0Wx94+jYeo0U42Ed4qcOW42mFMiYBofkH1JrwPHiWTYz+Ymnza4//crCgsupud/LCwJublVk5OT3Ks3FJp6e0a88D53DzPGXn19ncqZ0suZJsHofLYedlKzL2rui4NlPYvZ2c0Pppzlf8qhrvuz+ee+2loW2KMXAZ7M3zHnyWXO3lKdaT+OSypIPqcMq9JD7m61KTfnvb3IaUy3EXcojY9aPNq7Zzqkj/RdfqhecnA7ZCpGVei03i4IbX/Dj2E1x0akl31EWXqpKuS8pbQ5Q7ldWFoMoRJlcD+HDe5+28dlQMMq4yWYP7Wd6cP4UzfjPyaa0tC3DfTF4wNYS8ncBDGFp9CWxo3ll7V+0t1Jv+9QykvvhyvHaQfskwmbR/9fR2/hRrqWSm8kBRlkUHJ+1p0NUY3SCdwjVR4j0nu3xx6tuMmtbjjYGum81ZJUde+4c5BUF33sWIOgQxKXZN88DuWprqh2qEmtq+cJGXxhGy3tHgv79SE0dSUudQUSxc5QyMFeSODQENjBUUDk9NKz+4RUgu8T03664wKnWpXSENFJVN9JOL8NMREz6gbyehjnuMizLwzYdWUufhQ/3Ux5lqecDPvHFhF5WwuCPJfEysVCDf3zIRVJdKDQwI3REulw808KbBGOr2XELh7Ty9zLTJ6o/x3FNA9CDdijLdXLMFH0i062teHSHTnFZaESsuk8nBS+WUYjrjpSXUrlkNlUDmmOzrs0xw63v+ZcSpY4Wz40uT1vvgQMVxHknDyD6HjSNaJ9IniiYwJZqSQyOfIQhFcF0Gc2EvbRJ7PysguzqbqPBOjFitTKcWe/KSK8opyEr/nl/Way16Xax1yiboTVKMGIyGDQketz9s3t8Hytv6Hj5q31SykvAots/vr6yo7SqDMK9iaMxpZyn7eWp76sl7WG56bw5uWkwgEApxudwHHzZ3v9eI9vbVxkTSsLdKSrhCbFB4Z5Xu/4v6IBUOTUaCEDErDWV/ejdoNC3rLFzkRjM7Pngs5rQ2Qt+i+O+duldQIuUsEwfdBxYNfj4zKkWq6Jr0DI5tqN9AnsHYNYcRBeN8vye8Sq7YadzeMlVFbRkBHeU/zGLWsYQRqbUUtlBTAJyeXqPnwKXP0pjP5SRpvdzoqN2qobSgJGZKM7Eo7eijGahmTq1D1IN/n2JC+kGV2OSUlvaOyMKU/AxncwhyYY2BmaaxrY21pMRwsnieSx8UK8dwxsyYnFlYmxbc35VP7+xqUdu4/uYrIqFKyPsMp7uzorKdjY5tuauXQy/Bm9HtXr+ZGKZUYJiaqlmjmRXYk55IxHcmRhhb+vxJVE8PqEzIy6xMoq8o2Grp6lhrKKlYamVYa1PdqT+VlX5BeeH/L+Kp3I/2QxNLizJTujpzill5YzbVbS3H+WfV5AaltvqdMtZ1s7bS1rJyMDCxsfHA4DA7Dj8NIAew/ANcOsPk+4k53AmDzcMSdHgUwxwHmIuD2f/6dbge3yzj/zrABLqGHAcqdE8C/U5FAr/8yd7txfvHd4oM+/Q5e9wGwG/Ymdck4SHAVL4ZIQTWo10MRGP2KQrecQQpI7kwyLvlStSfVvH3dxqQNq6V5YZSfp9Xlsi8D44RxOpVWu/nOU53Gfpch7ElVYl9XWx5lhTJ24wzYk6jY16NfHhWSq2gif7tKSRPHUreUDnxE1eteJyEvSttUWlaCp10NgfVnSlXZk4phX7dSHuWLq8MihSadxvYBVCdV8A0bWH9MULbxCERG6sB2vrrsK1bXzMbUsyxkFbAsFjrvJIX1fboZMZZjuXMDxi/6j6Kkc6asu1wqvTS0K5odTQvc33WKkNuWE31NJ/2wTZo/1YPKozS6Htpctzzoanro+1FGg5WuD4eC9AlH3bl0AzujT3cT8PCHwPqr+qvaZwp9yIaLgO2DYOy5MrIT3TlevlN6YexUFwXYoht7briT0axkoIadcQevgX6DwRFea7223lhvrXfW+8CHnd9qPayfOh5+/I/bHf47uzel5wLwFODZ+VrR09ipwwflIt4XqmEEj0mSLdrs/b74fY0jeUxzAdbL1hh74IuIUb9f5wnV59y7qim+YvuNf6dK0qEx4tZaMQTMm+yG6M6UQ6CeBoO2uG+PSI5wE+zn7rMzcf6adbBfQGLeLOb9ajAvVLP9X2kD5vCuOmz7jROYH5ZG9B2MVxtA0Xpjrj538+J9aAx/M2354Ao+bwDx3ndkDaiHrv/gIdBXReT/Ni6F88++0VpRCoyfrze8cAdTeQMoWm9KV1EaMO5tIFFTPIdWcFoKCankJ0+ZDX17U2fZEFeJyNoYGj4V+vyGoy0jXfjiV+br3HJd2BTzV+o7J7YlNgCu0i19ftHYd1m3rbkYjTLGyxmQcPVH1gxNDn2wczp6dlh0VdeJIQ/NFpTJZC8wSjkAIwrqj3q2ABd3Q1EjrZ//F4AwVBuFik4tF49NSdWHpoi7Av0+yDOgxOBmtWEGC/sHKWz4+7/OLT/KxInma1/HIJop+W8BJIMRFFOBazukNF1Y+q0KPfp9TQXNT/hgQpmgu9qDV5oy8ZPsogVVQ2ItBbKUJ0pkZRuqE0DWFnbnwUC3NfZ071LRWeQ10ATHcZAeZiHpMzTT3eVzO2HhGJdB3rjb6gSszXDgYMkkpvtaA2ZmI3Mx28vkqNO0N2EZcOZ9Mknj1cHv5hJ/zTvogz6dZ3/ACDFi3EzRpq2w3X30mO79+pdms6lOu+44KxkX9eMuUnWr8n0wEhc5ALWNMywp49WWQbQsZ58OAJ7sIIEhvosrARCgZ9LcNJhywBSYomBcfhHRDLlNBvQSytUQJUCm0nRBRXUFZm7bwuwYyYEF7JsYYiany9ELeA23wo7gXw8EGWiKartFhBSZGmy07zkWoxKVxUTUpWnS2EVV/TQt+LZHh+5A0Ji+PwJ4+wgM/wrpfXGmX3OGeJAzv8IsAr25DFgVK9tDx9NInbG4zQ6YYreaeLNAQNqe53JAHpdyxTrEV9gRgATECoNqkRCRGy0bvCjBvkLxZMn8U0beKCekbW2xB0QDQT9pkVExzXMZpx8E5HPBSe39gCqorOwYLH36yQ8+oceTIZhicfSk4ro674xlT3Ws2YcE27Yo0oK9Zu0YsRz0ebuQk9vAm2wv0swoykXvxCw4cTbe0TpA8kOMey4mUCYZg6CgPzI4g2OmYA3W6WFrUjCkL1NINlvaIn+NECpTC/SgoOLl8GsRIZ42569XxE8K4I8xXrvlQbGDSe4zH3wPHkms46fVaY8ek8lLTl9vCMj2z+0QIQLRVaYBNVoDBsa1UKTd0Y1gasyYqyaEEJipnkgW1muBkN0sxS9iibmmmF3KLMTJi8b3MxwLU+Nbh/ALa6KtcWRNOAQJWgZHn2LmnmyutFYmWp9PMSIn7SSKZxP75TOch/p/TrBYtxr1o/79VDr1XfolAECOSg6A7D+uof81wR71vwj1/vF2Hv7oXz+j9K07fHQDJDg436PKZ88Nf5D1UrdhA6tA2X/ynbE0T5FSlcBTeA1fIYWfXNO+sHLuf3tONfjAlVASKeQhz/mIx4yKeXQPww5Yjp+0BDaA3XRhgSgkGxg2vkGukxWi54KDU1ZWYx4XtcRupiXfLbvU9OR8QhSWpdcpwJUjUJCMmM16molVc1ZazfukWh2ydgYVKM3SrpotfbaW1bXWPFSIn1tt9+ADfyRFJGUFcu/7awXrjcNk7NpiAoE1GBKmAyt9iUHPxfFlPb6v712pZAx6hJbARsoD7rTzLrWD9mpzYpHEUJaTFATEoWBWjRRIlT7YrYR2Dq09aVWIWVTyrs7HooF3uRl7q9t4IMdSJJi/8I4UvofwHD6CgeL/2xXzhFd8YZ8JcZ97pR1B9kvL2V7sBhqpNxoFJWnwJ9c24bCHoHL4j2BNClmO/k+IyyhH4U7rxGyWyuYxFkmkxk9ucpadw4JtNLysKBnxUkEoqHqlE9XOKyg/rmY79fgPElYjQzOziRICBNCl/Ylsw7Cw8atEDEt5TmguZPuOQUs31n5eTmBsQQE6K1FVy8ObfZ7qvbUp1O+CimrTgkp160Qk2IpQgWqCxGXEskQKeBMb1Q7rBVphIWz4KoFfMudnS7rs6TKi6G9DVUBZPsvEGyWg+pTeQ/RwHuL/rCA0qqRILEy9CgAvi72SbQGT8gEh82Zts9AGYb6GZzWjIi0hTe3L4QQ7lNYYZ4i2gO3YjlXD4egFMx37MYmZBoWwYv3zTGPavytT5RYtJKwUBDy2KoQwfFhZqqtquCjRqNk3fB7C9gkQwA4lbxrC3qpTv0wpBKe+U0dg0X2OYohvowKTDU8xEWpy0vipm8rcgqa9+vgvy+3olKPa+xaEDP+iJ7lQcR0SdumvnO9WhXKn/AtDNriXblpkvGEtM1Pa6ldmJetqE1AFNXM5LzjWln6r3KjB014pApBSM5eGTNjfjQu4oKLWSRq6qkXzdtx0kxe2zg0cbng6tYUGBSX6UgZUp/BaYdlM2RxKrqWGxYu2Qp3oUm4L6TBMjoZMRT4kNiJc4Utk72E4NxnrtNFYvRFzOoAcyA6pUKAopY2GNCH75CpL4kiTJEZZmmtfYnQJmpT83MsRKUxoOEDGgej6YnQ8Yr+IeKN+ilsmsOdg3ewS5GPewJShrUoM6+5EDLJCopbhG/dzHWpZWyyHnHbqTmklTZOCYkhkd9fHYVcuKwbVr/MAgNL7OVoSRoW+uls4N0H8YXEGZKnVWT5HhpaZK15lNsRlWahY60SBtTCLwUizxKfo2LTsmwANipkuK8p8WLmJX57NUaIswftNySFSaKjMsl3QNjkornfkV7p6OdDSca7vXKBfO2jwz7jifaiglbJUKBeMBnYo528PCyHeW9H9nB1w5fTQqB5PjIS+zYVSxMkfnKsp2LE1jICVlMUJNOVarpa1YoFDSZyyjCGklDj2kfJYw0P9C7jU83qj4+Jn4DLP1LsQGUd6XJDXaTFnsSb+0GFFe68cqtDlUWhJv5yH6aXx4cmnG+sW8pNzSWIkUotyVlGb2V5sjuKg8pjO27en0UlsI2y/n2w833k+ZngfvH+AXV/SyL/MiXrnE2hOx//IXANZG1Uh0znMlN+ZUh3Vg86/7j1xNRfQ8+ZpAL+zGk0QUvgiec55lmOrAkdUB9RMVjM9M6FqVdBXZPlk9ahly6PV4MuEQZBYtJ3Q7++/6P3E8i4sKod/Ls+geoqsnzEcvOYfnlihnSKk/WqYUfdJ3026mb5HHq5JMCvX6HBxl5HT1/HhmZXwgj8pCpLVb7SzIsZuZsjWAElBOfv5RRyoJWTko7ycdKrQrjwdVyLF0uXl8461q8AadVotRIR2AByF3hzWKvvVLacUVilFgexlZS/5RbSuxxxlCSzoHRuU/+HH35SlAjT8IdhfFIu4Cy2FUZiWU6tNueB3hgnLXBM3frd2Vc9TKKpIfYPS98z3BODl9GwlMJSvXk8OIZZ7OqTDUgfNyCxYYtVw6FfRvHSnHp8QEeqyB1lWqMME6vmAsqd36zZbeYMMY3+NU7hTUCBx3nPraQx48BeJhDeujGhEL0YVYsEusb7E5q3M0Mfx1yFJ0wOmlu2WZibtv9jCrZBOdJLGeFHCOYqPC2iKbk6tlPQgNspCucsNX0iXRsF4H770mnWiWyeYJMN8A785GlzYWpmdfM7gCWWOQpiTzZ48tBUZF9N5wMBV7kjeV/RQ7MeFdZKr5hVoQKf4rWABG4taXjNDuerAmEhinHrW/rV6RAJffKe/FU+PsLf3QKKKuDFMoDY5xuISAx94bKX7sXuMW+cwdD7oJT+I0dUFZ4Vy41G/Qp09KZIZI3sdZ0mTXzBCnBp3sxS9LO9mXbj0atVH9eTPdTQcbtBAyTOl0+mGMOYCA3MRy/4iD/LlKrXXzGjc/vFO+I+C4x7tr7y8e/0ykp3ncvyniLBMsj6YRJF78GhKtz/M2fZzW1edFNlLdapr2k8q2FG53eiL1xNHDuL+61tL5X5x3vu4H/skRsY9pZfzfeI3R58avC9E0Q5Rek609lNqGdPaKZZGCDk9c5na2dl75eA8FP/jFGmSm51iVqi/Un8+M3xeuf2/fEg3C2Tejq/vJ084rWK+yBMNoiT9WnCZLrkfu8ZIuj3Ec8sUxAgfxAgfxBpZkR0mWLU8LEjiahGMdxKDPxgHoa0KWfZLUKSzSf2xAi1XEhjgjMnvx84xMm6hI/e0N71QmQDvDs34gS1WqV2HJioCV+ymv3bq12yheutxONQeKT3EIFaOjWvduT/b1pkh2uO6G6ao86+phznMvaVFHBf78poZlayoPcQGTiN2kuSrd4WTM08lTtlkIH6zRkar7jrSv4osBiyBWT1v60Q4+5DlPgzBrHNRA98csFzCZ1eLzb3yTAn73rXj5MK72pdytxSWBam+iists1n2qvkcvAK0s0Uy82NltlmPXJlx/5BnnEM8zu6XODHZhQRyY5L7FfBiXcIzSI4U0fDRzXC31y3Cp+xmJqbwY3iAF0uWcyZGCmol3YWHCSKOb0mF0U7dcqmZbJo0HHUt+xwwgYn+dDzNA8dJYIAavDHB/RCmLckMwIhi0BCXDzeocL0ZLWhTNtyrKWPWP8cCh2hit5AmEGuWUIsND8rAfsguq7R1eBS1v95epw8/XThAWH9wDGtiBo8D05HFHS3XWeDGcetzWj7EerlEXFFRre2IG4FbMW2AkNaoo9cN7oPnj5pJ9yZkKZmZXma1fNpbRRZr2xPW0oQplGyG/QXfrJX2n7/YqocV0yqNkB2NmN+5AbfQWPs4uh3O0vZWWi7kidXEr0tLnS1aMMz2kkJzusqNaP0tRrCSOk2FSIkUvZNyiJ3ocs7+fKOYIUdjvBtq1Kgd/cPaXpEjd9gg3Lfvcde+w7Fz/IUzOJsroZtvdssg3P9hROToDLb2hmvnWjU3wgTphRlLlnI/cs3U5nm60m3Wq9bMiemavoAqolJlN/lliZXjpI1cf7UCSEgallMElilDZS9UkCzI14Vt22uTWl0p0RP5sLRNEh3/qFcH9z/xAJ6pclLoUiEjlE0G2SNqWrUlVJ1t2CYdq+5J7mJDrF/Tqf7F2kJFDK0A13aGWhIFiVWlIncPBoVgq1G1GlXPGms9vCGbpW5c9w/gBu6/m1fx31dcXLT6qyUx0uy36B3a8MzpwoMr1++z2a+aVCMjWlUuL2/IMmvaTPcp3Edvfoi7V5GobB46ooWiqXevfNmDOF2ZjGYdmzJdNIYcL9SPNYzMd8m+oE67/9+PDDcA+oJnaP980OjHqf13tOgB+Lcu1nf9P/9/2m8exGkcvG8ACtgfdcgGwMGVcz4z+02Q4c1+NUoFK+q/rf9qn9LZFSjzraSZibjuiZg/hVSIsL6goC+TGmRCs5htVRNuFZItqHJYw/YejwOG4QNfqKAZ+bABqcDrOrg+KKxzTk0u5jNY45RVONZZ7XIilzqh+dvQUpG09AzN0oEQzsOKk7qmDLWM2RlJZSE4YmttfwCkrWyJi23xxI2ebw3OefZzjcKSV7p4Ce38dBaCxtzCOb/EtUVVD3MnWxTzuBv90QrRj6MxPUXPDKVTnvfM4zd1+PQ67ZnBf4YrrY/K6ijzk0NZfdS6w1FnpNJZyUunpZRfT0PBn9c2zPPhKOOQ2AZ3Znx3amzgGeZ072n69dl4Erdi5dldja9f6vQXMft5rSkRUwln/VbNfMlzuAvZLHiNGjVjUegkyoJ/s+RPa1h5/5U7TQX0e4b+vOl2rrRJ0TyOGDWPmvotHpWpowfnZ0HousdlU2G/aYgZG4xtnhexPTWfsoFlgU6AlUP0RxuQo4795YMJuRCbxjwWyIYsYrB/SP9cQrV5Xopti2wJWZBF4+tX1vqrH5DtjvOTJhM5Ya9iNim8siELQGy2qltc5/VLy94lfDcWUE3kx4qhHpMy1qRNbqDeDsC6nu5NT2Vd+HNOoxoc7z3hfZd2L+72CSXLU21VQRWKdiiCvzE9Rg+tfk91ZvJbkLBZbRDg4Mq8CwDzMUQnlfa294IsPA9S2dOlyosrTXYs4qzgpCHAv5hAMoCo2uQk6eovgVP96axV+drL8t9MKyjt0xqT6WkDyhVl9jmctuCKs2PDUdePpup09QerzSOA+wA0DcKmchoMh75pcGwuKog+u9OQpLyYhiJUEpeVg3PZMxKDJAVZhDDh4uEpkqfwnoRnJoZyIwhCZrVAFETWbZAoBJ+jhozbeW4h4oQgSxQimCxQzzVcxPPnk26wIAbJ+pVL8964P8W+KwB3ECPQK/ESeCEYjAGhnlSYBAQByMATPuS/cn2OyLvEqTJOBCTx9hTZDiVqtG62Vg14PAiboqyCkpqWuT2ohdajjBk8dK9MfGAH1axMokmOnKRRi6wAJHPBg4QLISsGWRg5BBGChCBajOKM5VizYMSELScmZOJYKw/4bAAX7WkBpICg8BDn65rT83Cc3L+f2ySjKCtfE9mhBmXBhif3L6C6Rk3wBxC4h6ExY8GKDTsOnDC4YOFwO4YHLz78BAgSIkyEKDwx4iQcJ0nKgfDKZ0iTIUvOkj5FZ8JuNSM1Gh7txlXXZ8CQEWMmTJkxZ8GSFWs2bNmxdzb8J4IzF67cuPPgyYs3H778+AsopB75ClxU76VC5ajaDOktlBJ35KkppjpQpgHFsgfFrN2wr774ptuYDevOChSkUrArQly2adtV12w5EuqGHdeNC/NBlQN79oV77a1ikSJEiUZA1ClGLBKyOAniJUrySrJUKdJkSDenS5ZM2XK88Q7DTTTnisUt990u1jpeJ0yYNGPWiinTVhVx/wjEAXGCS2AeXIAwEBcoBe8hLISDuKFjEA/EC/FB/JAAJAgJQcKQCCQK4SExSBySgI5DkpAUdAI6CZ1iSiBGyL8WR4URUkjhitum8WKIgbzWCRsqoo+SU2OkoqER/D3o1UcjZIjyJ8BEOdXnJ6rUlBHeW2IrbmpiakqUwsZsrxOydRNG0KF+EcuIiLAAJ4GwuA4Ji6uRRMcnxcg6OYyjY4ghKsGcGkLelyyu/HkDdfxrq1BEYjuBjotI5jCPBviaPaAA7+yYGCGGuhJ5GFhxAABrc/AeB8CB9mnS2M7QwBkwAWFgZ6AJLiich1kuTXlJQQxAnwGzkLmWrBi3TJuFuZurn6T7gjsaKUvyCOFro32GX0hVaXF+TqFifUwVBcVUleStKSF0Zpi9hoCYnU1UpbjFkuhvpSp8WfOCbTliuz1REqQtdm4MGzNKHNqKJ4S4xKmvfEqYe2PsDQz6wASWlekMDbhWeyf0BKC4Cb8pWZGr+Ak7YqhgnP8RrYQJPfzImpwi0LkO3ke04if8qGCb/9FrGDE4cngobl14KA4=') format('woff2');
          unicode-range: U+0000-00FF, U+0131, U+0152-0153, U+02BB-02BC, U+02C6, U+02DA, U+02DC, U+2000-206F, U+2074, U+20AC, U+2122, U+2191, U+2193, U+2212, U+2215, U+FEFF, U+FFFD;
      }

      @font-face {
        font-family: 'Roboto';
        font-weight: bold;
        font-style: normal;
        font-display: auto;
        src: local('Roboto Bold'), local('Roboto-Bold'),
          url('data:application/font-woff2;charset=utf-8;base64,d09GMgABAAAAAD50ABEAAAAAjZwAAD4SAAEAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGjobmk4cg0oGYACCBAhICYM8EQwKgdhcgcALC4NyAAE2AiQDh1QEIAWEageGfAyCKRstfgfYNo0G2u1AhCddVj4KgY2DDcR7zMhALRV0/2X//58S6Bg7aDtYmMgIJLaKxkKneetD84Vb4Ra6Luoeq1pO+Jy0PLHURYbIWPkSu0CNxcLM6hFZ85jRaSM0ZHWTX+T3P6rQmnRU6V1/deMv537KIQ5pseeGIZiDN/2wZlKz7SU7od0ivr8gMCpDd3DyO/WQOTvhLtWm3vbuOwPbRv4kJy8Pkd1Tr6qrZ3b3REQiosusFFIohWZ0lxF/hufn1vvbiB4MAckNtBGBMWJUbCNqDMYY2SNKEJEYmYKSOdoipUSPFoxEoQ3Mu7MO5/J+hMJWTT0B2wJeIUmBrNz/6urfK7LQkizjmGc8u/xHD2g3xFV+FcCiyTnIRbc/9cc+2HOPLgMTKDruEPqvZXv9/8xelvhLAbIwYykk2SUjsCu3kApFrVLUyFPgghs/3asOYIGRLuOsYCs82P6Z6y5rtoVlY6PKDL3Pfjjo1NwmzULFKpkjQoj2MkmkJY5IDoTk8u8TcPpnTHYM1sacYijZUJMl/+c/XevPRgZfapQG8BOYWPU70mnNSJadzO5a9j93gFR+9d3uynSRKXESH7BhGinXSU7RPEELWFRIkuGAH/4//ZnSlwH42wsM1RZNgIo2qdMW953ReAno7zXeCUaT8VLFIhCDUl9awYxnQsm1Sh3kTP8c0OHh4YF0kAPV+/s1K7VV//dPDy79XVZELsIdoENhrs6dUL9f/2y6/++eZLonU+memapMspTJcGYxs0Q5ZkeggJIs5gjRAqozYtWxEO5q1dYpFNKdMOf/v6pZ+y4pUpGH879z56r8pGacK7troEdwHgWQ1AwgTQqkU5THIe3qf4h7iA/pnAEcQiqacZcqb+ey29Bt06/Zfn5siEEcmTfWEhGvtN+zXKkecCu4FUSQtcarE0LrltL+kPRluNK9/9vOa0CxoAHKyY59F68nfJ3dMi1H1X4Bhl/7o64OBg6yCfLWNpgdP0AgMMD8gIVBgACJBwHmUaQDsdMu2yuIn/ji2SB+6rNqgfhZh4CAOATAY8u5M0/2CHAC1hyCMZW46+J+Je29dguFYhQjVMKkNba+Nt/Gwzz5c/E2n+J5IvFpniGZ1JayKCuKO59tyCZSyOqkSDNq9iXZIt3TrNaIZF8bL59PLBV3PawDkhgJ2WL84yBECOx48EI56bQzzjrnIkVYKnBUqcPTpE2HLhJT5qzYsEVmj4rGiTNXKVKlYUqXIUu2HLnyFCtVplyFa8yAWh06dek2YNCQYTfdMm7SjEVLVqza8BhEvSkIeMI0naJNRC0REFScFCH3gZB92cn0KKRInTDjXiJ0gGiQmCGjRNu3zbF9tHY5m1RKelKlYUqXkWropUZNmrVoTbV3oEOnLt0GDRl2063U3faNGDWWGm/XZJim9fI+WIP1DcSpidZrH4Kh4pc5jo16r+B7R7ND2r1Qi4BQLIT3B0tvu4QToin2jXFqWUhBEguRmaG2Ot2pDgIfYfoEEzab3KFAAK+DPn/FJ7ewU+gDjcZ1N1SrKRbFDomnxbMthNAuIpCYodR5Q/sQOkinLt2mUzOQFi1ZsWrD42jIUhV4EDpENEjMULTr0KlLt+nnEUwJo1LmRJBxmwO5TYMwZNhNt6KWiGGDLJWQsWzNej1Zhw4dOnRYxe+Ak6sHtY+cegWOr236fdXpIxjTPnBqHySzV/hxt4mPMP4W6RNi2j77HqO2zx1KSN0S+0dmtdqacKdxj1pNuj8+iGUoiDLFB4VQBSIhMVuTY6CEkw6JccKjfQkdpFOX7tRgDEOG3XQrTGt9iPx32NmBAM4/VydJDDDxj0xve6dSb8sO+quOHq2T++11me4aZU9Lfe0bShf6WEYBw2sQMhpPHu/nHx+th5/Qb63yZswiJxbLtt7P3T62Lq9twJcp/5Fz9D9S830LAmGP7pHK/8XJ/3lvmGnNLPLV3EtHODPrntzQ7d6k2moPR/cxidKB9Fhve9zduycFNNFhtQQJNdNmn6h++T2CHSeUX7VALb0rTcXkchlR6wY8kA00JQS21U9gU9mnzpxzPl9XwJUmt5X/Hl8K65qq3KHKA+yzN2fnziv46L/lPkaHEq752pTPm2e+SaipPCcW+Vowv+Dwln3jj/in5zULGhRx3a/WQdjj1yC68RpKazfs9lC/10ANsZT7Yjrd6ppGZbQwuMYD9YyLDfOs3veoV8h/a6owPLUGA9fpUd332LtLuSZLeqV3DZZH51u4ebZEnuvYzLMznT6I4RN2UGA+CkFSGKHycCedhSBPBRd1OseexgiOI4FKMg+WYsOONHsqi/ZsyqFzcUKKDKdlueaC62ppa9DKQLtuRANusXiF5JHN4NbtLVrjYN1jzmDU4yGiRJRIYAkGCnOKHneaCjpDIWcpGwXK7SLloUhFYClEhQpTp3w0KDc8FadJxWhRJG3KS4cKMKbsTCgHgjiWbi1OjEjbQiCDwtlRDvYUhUa50KkQZ8rFRfLLgGEMwYKy5WFTXA5S6hrIdTW41RrJKw9mZwg+pkM3TgPBCINugRunXCYoh0nKZYYFumiJLluG15qeqDWiEtalxCvPiKicRJAIesIEiYoQosJOSnZ4MOdBYRSoKCyFwVEYNcEvYS1uwkWOERQRIDwECeKlSSBmJCHZCJwgPDgKKMSB8nIUbBIeECfh9PgwIEWEJOwSJl42TJUqME24CA/mYCAQgTNMumsMm+SEx2mqojDTFDKTLegfC0TkJIJEmAgSYSJsC76TOmwJHlaeU1o5bCQhtj9ixsHvOL52Q3cZj1rPHTTeLDqFVBMM20DtNqJFyoTj3hS1FEId+DvFE2XInoW6CPX51vtnUdmG6S90POwD0+oyQAN/N9QEJFcEaAJunx0HpBOIwjGxrLzXk5z+FUVBIA8gXKkHDPuq/LbAmbLwFozF/j1Kkm1q7Z20ZtrUlJ3MjURhN+E0SQjEJw10sAo/ywDf+0S0Afc908Jtz64d+w4ceu+DjzrcxOLP9ZEEUaJ99sVX33z3AwxEmBSg1YZ5FxvQb+1YIFZazm7v8XmzO8u8RhcDawH2BKwMsOu+hwWggen/CvwBThkrE6BBdwHUtp0FWBn8cF3LxdMCUIRP3tbQDou9WgtI9DdKQc67OZNP8/nKiZ6Lng+9+NzO47ybT+eH8+38dj6XH1+nu/C/v3//L38Jomi1e2U7abG5mftDfjDf/GwS0x/lXblXiqbwffzh9/d/3/9l7vXk64nXt/NwHsr9mZWbcm0uz36Ps2/ufv0DvfEOxOyC1rWn0R+W3EJJp2lrElwALD5zI5xV0A2Dp7YlXLmQnUV4EHMsmgkO4/iHb8AAnia/J3rWh/0D3Xh4xt8rTrZ8Ke15uHXgkDk8evDkYIdgax38kBP4IhlLVTmO4+U5jhN+OJwRFlo7LXKJjzWGruWxXPRGLJLSpvdFte4QjkECu8koxk8HkyeNp/t3ioedJ+/LoYwEtSckr2QtB7RHQTslq+pQxacNzR+PhUhRJ1pt2eoGGxMxEs/WY3y3ElWLWuZRnOlgL9ozzVBjTykBXwTn1s97jboVpFlgLqpUF/AOvcPORIJfVVmd3z/ENFg0wLMXbXiYrnLNHK/lnkzpNeuqAXLXFL5nSphNBOO/j7xxIcHE6BDpZHE2NElnxohUNDOmoj/idHRlpdd4yr/gPvBg/xh9gg6sDN8Da0AXKYqQNj7yKMrFxrbEJpyfUVccxsitDDTsaIHJXNahmikQ8hEHpx/zaF6M3rFiZJ1hZbucuOUvi9bhPLSL9wXcciF7BiVUdgXiCo3i28jOjpwh2yyroHSrf3tSzVhPDza1hg5SsxCcUdTQ1PL2QtO5TnltdJVySvlGPTGCOCEGo4zaGpqliVOZNbK0Tp6LjKdGKkHFzUc4aW8GpypR9jqjOlUpHYM1XjltT8v22y1TG9pUVO7m3teUHozSnXW9SpytJNXK0OaE5lpZntqN9MRb00hpxeWlFoOhxpRCeEUbMxohjdI1y+w7hNMlFZRuKKUVrc/oecOtPtG0LxTPlShVZr/qj3l7d23Y8nftBDgsD2iqximFKKOExZxr5InOLHqCslSTUDWHiZqoBYrSxiZJHDNjYHrZAAXkOciYUUIgygFcrRoIIccMtUuIlPMd1rkUWLAjMowbEDvnnWyuEanG8w9aNs2XDCaA9qKR1vWFKfaAkTax16uX4q172GVNIxj8xWnpwr9UYazPBSYTDuytjJ6rs3YUiaW2C93EM8oGuVwZ7gadhqj1TLuuGzXLypEVcpEy6lFQKEdn5EQZ/YAxF627IRa8J4pc1XDP6H1Z7zJ0taPg7QRVud7GI+LGCg4WXDUkQ2Pjuu9LnnSb8gSo5lym5HV39zF2FAsgR7ply2qsvEfCsArlWiqWwEXn3KqcErqGzgMMlBHdtvWfi7G+FrQS8gREfZbjseQy3sjMjBmvrFk5Foh3rNv4xzjKGTco5L/QysDe9bbGN65FvvFp7FB0eMiZIjtcwWqhWWJ02J3A2B2ka38CNBOR0hvaR+/on+oL3RLGmaBOWFm8YKHjKfhmK4OwyLmfTB5LvfyqVSHzO6HZ62zznL6G5udqvNtpfmfoQuWaZDWRp9WGGDba12RS7zpK4ibUFfrpQ5x95AwQFlJfI+cmC4D2tu7pcwUQLXNnWlyD/kty2fGhwlUY2BIryBuRWck9a6kceP+ZwCjx0pFexx6q4HtKDczJojnClvVH2tnVOxiokxPZI+8rnijQww3HND1wkWQ5Lap0oZLiSLBiHFuBrwUga1iQ7KfKurJ75TEr0y+tNrr7/RhnRNccqjk7IKdOBAHdfNXOTb3KU53xTngxfb4Hck2uS7yRi9FHJj9bUkWim4lLJ1iN5VRxA/c7mLDggdrekVt9Odw9RcN4QXrc1vPhBnTFLGCaCIBITuxooNwT4hoNxQ5NKlhl2lL+ZzUHAVfNJyJqvpNDOEw5jyMl4LaIxqWDNLQQCNKR2QGOXeoXo9Cossgw/28MGQ5DPIy1T0FPTZKKq3qmNN2IMUxEKDUlH8r5pls1GZkmRCucM1EiFMETh/o77mNIABXpNAdqLUxdG9xIjKJIh2gu4YW7Hxakxx/Yuk3JdbVFJxQaYg1vVkD4g5uashExcuA6uNjU35HOJQxrfcgsSvaBn1RBrvNWZMJrMtTbEl9jos/s536bcDpyOAIOO3tlQvJcQEykqxvob/1IUX+INk6wa69CsUo2sEzihBeSO474n54xnUs2IaNZ5BEK90jreOupQmTgfvaaPBH6kYYEbbQIEw+EYtSsadSgTT4BTubZlD8d+NMtVnAosQrHrtoYOyjF7uKYzOdL6dyA3GwSCxPaSTw30SpsvxnIBSSgZZvFgwsXrPC6VtpCMZEMOWifuw/Pa0K5BC97KyNAcmQi4NaGeNNFLaGwekgaBcxtXNsA0Rh3utUYhM5rDO40YgeGgGuW5YZqW4AEBUWpPCqUKHZVvaSKJekp/jsQkXNnL+wZUFzFciAMOLkS+MYVJw/HsDT4AEpyaTY2rsa4ZcbQbpsQVtwu9mJ1lZLHck9e2X+fm+JJCJdaRm+VAhOLlYCbD04Eu/4beBgpIxAxuWWshsM2ZZqZww6VVIFf6hca0duB3vNIy0rVxxKX0Z9D6DeysymakCTB0CjkuCJZZEZlHPyXd8ZdgOKo4pKdGKesYqNDp4stxDm6L4GIVZ+4sOb+12CzYKj3vX9vANRXkxAyfYjbu2OsY1PRlghG5GnsCZ9nv5LhhUQLxuhEZDBI4UFcY3Ec/LWqG/hWhisNWcsyJeoKZN2fqg0RGBt5pckLyckU1KaSzcFWsDkw/U291S8T4FiIhP0KT0hkrHEEh5ZMHYrRtiiz2RF5jmwjR/ImMSZzrZLrQDEfjtfYS4Fb6SVBV2IMmCRodWjsdGNm7QuYSsBIya9Zb71ufDdnvEzHjFdhwbFATyhyHgssN/N8o9YM5EqRb8Abj9ddGxf+8fTFVWOvkMLJJILDiqCtE6PWpxgTxrK9KkCSbeJKVhwtV096ZofPueMUl+o5YLEGhcAf8mW4GVbsmoGsJhwIFtQPoqtnNd2SS9T5u/l3fqlYf5l/63UuG0RhB5dtLc3uyPrvAXRWYWRI1jb+lRzWaWuqrW5Cn5qNwLJhmaOSzuxnS1MPQrH4K2/MD48oUCBBcY0aDnmi3hQF2iKHXELFuXbhyXg6iSeduWtCi4/vjK7FdUbAEIiWAJo2vOiRReOcXQtfq+GliGw/88FE5sn8auT1lCVZZLmuunECm/Lj0fGj3PLDUJ7Qjm3xzLR3QnO0YzxIAg/yhAACQmkHoi/wtmZTgdS/2dO3IqeAb31uYkgyfR+eLFNL2hC5xjWMt2ko0R8xgOQMGBGtxRI36j/EPTf+MLaStrBt+xGmfGHTFqo+tdED3/O+WLibLfBK1T0fQoyjP/LEvK2DQ84ZkDPcumT0E0zuSIWrMZ9EpRgaNFUkYrlUqr0Wsin6dGX9yXmjzFPeuC/zr00Qrg1LobedkJLEbjcHsWbIoEk0HH/W/f/ee935JxanGU/IbvVktZL7FVua2xObG9YMP51cj7aNjT7B9donLLHZr/cwsR7RZFtHuq25g9MH12t2/gFqGU7tq6u3hGZrZh4ee/39H0wMIzGA6k0PZ/tawexqzs3vaswlpnc15OZ1N+aMsWkZERn6JB1TLX0SXs2QqC+TcjG9pzEnr7s+n8jsaMwv6GrKHIOrESxUL6WbaxkSGYZEXehrjpl8ZHiOWbpJujejo8xPz55UQW5fXxtqWJoo7O5JDbX+Xw4fkfNdMrnnyS+iKaXWf/kxfHMP4UfXkDazpJr5OoQEQagoM4cwc+UmeYIXiYTXMbWKFMQFSxYPn14TjbfairvxXidLW62qMLDhnoLMxbrp4lC1inStfZX4YvgzpJv65tW6L7pZmmoVuQENIzAM7nz9bGFY+BMa/wmXWgV7jjxGntSg4gdUE1D0KZSnwiX8kC51mauaMSjXf7w6EH3e86I/m38FqiKALSAdJXErqMxSTs8gDop9/RXMgpDgNzK1/2P3sEKXc43pFBMCnWJs5GRHJDjZyd1P2MAwL2ygDMNpCv/pHn34qQE7wav0S/P5T3XYCfTxQY9Gfx+367Bmjz63zsAA5yaonYjB0KgBB7QNGTxpe2b9m5s//QbB3T3EyYPBDJFNS3y2k1D85t+N6aDQV+klpvRwJ7FiamWIf7AT1c+dTg6lkTDhlwaee6ftsD2f9Ipr8ZC/dD62J3ZSfG/vqfDWCMb2ki/NNzKI9vTTtULN+hNNe02aGE0K7+DJL2MnTmFzDGBo09wH5LeKR4Zy6j6qkUsH0G5u9MsXl8pT3wQkT8DjpTlpQV5UD/+cqwlxKQzfb7eC1XBjHyTvwT5Mi/ZERPWOvhJ4mXdp6/WVvG1xXR6/930BljPPwd5jkzBiB7UwrN7XObwoKiai0MXoGL8cjl9JzmhmbR+B1U+9EODfQFf0V47vi5vkeD3D9WYiLr7fT4mu6NcQcPvH80dr/z5FYo1dg8Oc6cEMN+fAMDeXgGCpZxRHH1sbR0+qg6N/I9U/STHchBFSPrHD+SY/4cOr1JyCV/nxfKArMMi/xozPBBx9SpB1oyZehKKY4tA6F4fQ6tiYoAo3dnaqv8acGG45+LAJFhPR89hPPEy8UeD03SCjeRHVsOAD8wqEiIrQRnMMmwZqNb3U266bUmmQlSw0+nljZW3v4R2KWZmLk7W5GZHbXUtS2ZBmn0ezD2ijiP8AuQXbinH//R3es08gyRh5ZtcV1XxD3RdsTAazmZH5Xvr7yvpclqpkLXr8OlsXko6Pxk1cuNflx70r4K6ZrEkePKEvffLa7IKiP2fE2lA1jwwP6u1gxocfP3G9P1/3agR3imGGuZIDRdL67OOgsxGJ9xI1r8rze57XxWyxRGSPsXQx0kFDaEIyYGP94RKcnwoMrnc/GSqR1Ba/wrPxA+KKy4QCor0c5xZgQqsvN+G9nuH2CStlVoVbyH11PiCmF0tyXCnWFWof+oXlE/0iz53DTMwqK1mH3oQc5j2pzM5I5Eol/JSPjyt0tuk8MHzQrHmxaxRwRY48LGTd2oIeWbwcfterqbMZo8dsPFoCbKyFL/VOetRdK1mPLC+JgS8ZsdMraI2+ae12OmBgRLKxUgNa9XxapCPcehsu91384AQqISMi9lrNFth03uraa20jEH4KvtCOsFUEjzBIjPHZ8pYkS3mLicdHKyX/iCX/KfvS2quI3B1of0Mh0NHb3d47KliRRKhqqW2/ByUpA+EvwxBMjOFZb/OuT5eP2rY8orPoJpaoF1rUCJ0F2FgX8qS6xUq0F8RStaS68obkOtqiwSMnUkZHx7+SJ4rHx8+b224Ob5QbivcMD0p0VRmAZeJGpYl4d5B4d6XJ+kXwf8P7ivKGfbBJeNXwrbK87hBsErsANHbnjXrjvzFpz3PXT3yHs3/mjUkI9Qu8nBICoaxsJ4cfpshH0o5GRltx/xI1iCavC388dv07JgUT3VopTZpJxuNt+Q3QcM7PYfHh3r6RUXFHnmo2iZQYmpoXTfFH2tvo1Jv/+lZd/8Jg/pMi73U5JDwkjm5OyHPNOvvXfO9t+4jU+udW1KWCR7kXjtCBMfY+5o0joyPyIze/1F+0YGONfTx3DP63rmAH8/IT+RnJcb/hXPe1q/yEGwmWMoMsDZlSloW6FdTIa8R7XhjHUuBfXahNhfkunue14xZAcP9xO9N/G/nNsWW574Wz6O/CcB7YUsaRfDoFrZBPlHpbi1RCls8mSWns08sjCusCgm/xi1GniWzaWB5gx+a9YgGOI9YJ4LFOn2K/cAYF5tVr9a/yI4XyT0si6rvmts+tr9Tdtk5rgKv5/NeQuJzd/HsUTlNkUzXTL7K1Zmk4p/PP8CeQpmNm7kgm2RprY1wialZpqXP7c0OPwLWzloJCc3qB6jW3g57wlQJVM+M4w00U4oXsLMuPyRuOAOwAc9ozsmHmtSwnGtHoW+abhWV0qIRl55zPFNb3UVyz9nSAiAIgOGrooVfCLs8pBOp/rrO7D75uQ2MCENnTz9bbp6hJusW70EL/xO/N89PVPlFnZEERsPGFBzLbx7bl0d8r/Ou8maqMDhwjbdnTDfXhnNwXyYbLYDur5OUfUSi6l88/50pQi3NsbrWe0wsf7pRY+4AI/sAiUcjV0y961KdurY4+tDR3V8seBXulrtJwzWFjbcPH2+jEf4cX7/d5xPF4s4vkJS3vBd+IeeOiYXqlJzC2MuLKpTC8J6Ph3ifFX2jO4qhm31R1j1kNj6t+0W0pYsVT4ZndboiKQUyXsxXV+Yq6O4QBRYAxrZXFyyqL6tuTzUwdyPoGVHIRlawrLoyP6h+Z6TczRG6pn07JjhFpbSyzv8oy+9Hr62s6+O99shpB2MiJOdkabW5cKwuKQFZK9B2eMzY8Z2rZojGscZXV8XChX7aPTrBzSlaKB9uYXhcS2TFe1fs3Bh8rWoLnTIgouNfZch+au4MZoFvZOl/S8v2Jwdvpn6qL/7mbWflMmEdgCyL9d0x+TeQ8DM1RGVEf5B9V21se1RQYENFobLiC+n9TfqLRK+wPBnhPebn8/S63zb04jUCzlQc0+GQo+95RCchYZOif+ru5mun2SRVi/AFsT2V/ezLqJ7bOo/+rCqrzTFP1H8N5p3oF1wXLfznfcqFROWQKgxfkSLIvqVS8Trh5DuenFSF61fpHwYfxiYXvE1UYHStrCslKH6tIw2+cI4m/Iy+W/B66n7HiFtPqIQQ397dxJNvpOEuWGnHfWrslqbWqr2jyzO44TZFNmVC9Vs1t9z044OpI99AsND6NudNWWazq/UcWj7SDu809VhBZwwuLrOEV1PUnMnNZooJG+M8PWx+2Hgka4UVzeqZ7lt24vw8a4LCCeqdVx8ljZDW908qCqmRYxWytqoTKZqzb6itdPaFnLFtrJX8MVXRAW83o9q7gXjLrV82Hfc8OE5Kvr1fQ7GrfYjd8Zu1W/9t+ZbVaMwmLLOjSymYfrc/p7Rpirwx7wYmvB7CP9qAw0+U4+MHa5pDDkMPOMny3XF2ttk+pfxMMb8Bnuhf7lp9wOLt6XDAnH799a6fYNFG9qdoET/C0XIduD7wps7yiWV9pqGnqb45tSzyCoT5hUYMnDZ0oOU4UZpFtULaJto8eEioYX6mU3J/buy21KrMp8nQZc1fm9dybesmbL6B6JETx9LHx8S4BNZhWnwI7rC5bVrw2MfdI7ohOEKxDVNUfVrJvzn/fW1w7ej0uQ7F3tDGwd3fj3MQdRhoiA6sT5x/cuJyUkpPPzPCsmn4YVJtftBTILagMn5isjMwvlgLFZQHV8xPuVVk5KKAeHh8dOD8aGRrSsGGx6JjAuZGIUAYYdm2asp4Jr7Aa+vef9qAj0N1oEXkR5W7lCOWerwb3NcOu8EkgJOYQ3xFipIk3Q3VUpvftHqGZz5D0owdoUL/icoURYaqrn2QT5HUzmFYaMFBHT/e51SG2/PGHwJv7GIdLAYEhMRZGpBBSmPtksHPFcrjpWU9jW9P40y8MbBScdWiWUaeZojgKzoKorWNG8jMzTTA3XcaqWhPxmpYknMryfxWkjVfsKrrr9O6uDYR1j65VN3Q2ll53c7Kl0r2YgBEf5c2kOzpaezSlNpdKCrY31CAbqmTsKmWQzXpCbeUyNsiW+duOpjNJpjO3HecfjtCI02MTxNk7jqVO45V+5jYJ0cmX/ENaYrt8sFci9YnKip18ft1JGelV+Wla7setXa+eIZ9ozQgwAxRNJSpDSzB6DhHfYShBeUzxrG2QD3j438VTmk257fHyroxEBkN7QTGkkd2wDFk1UWuub2BxIy3D1EVXxcQETwe5Rbgmjr6WvuMc71jhdXUhwdW129XXg4Margtw4oxMcCpGZgEEMz8iQekcuZt4RAz6HWR1ZOXwW2ga4Xbgpj9QGZQlDY4qkkXtXJW7Li5Ett9IL6lNijEhRATaF4e7OgkKh9nGUOUylc51S/3j03oppbA9OjCGqVR6Jt9/KLEkryM1fEHWUFFFy0iOHgfoxULNQFMYd5ApPoUPTbSO9ixV8/uJwfOxGVKpGT4E+ZsY4D21yeK03ub8vf6I68/2OeCxzmffNHai5NEpWc52JkSa/XEqe1upeFHI0JVm9maGzTkDaVOEdJ6iQOXDE3fPVEfFovQ5vNxrRydVxyaaiTV3Jm9Uj9xr6EZ40IOtLWmBwM3anR5sZUkP8sEhryWnaTdUF6sTJEnyNyotaI6QNQYaO1pfeXQwf7emosKNLnnKHaLKKcVi3B7FVT163sgCcJXPfLTZnKx0kvXvoT2/x/fDQ4HMAAvIUU1UIx51dbVqkweGB2LqxxKGV58VFvbd2n9qdNVWkvrMi6tfQi9SWb3q1tZyUVVRteP/FlTEXcSpk23rsM02JhvbFdzNO5qa9NOYM93boZ4sG1L8nbTNvmkyPkmzU5Ex+pWoFVg9fTJjEeUn/YZ3jBWcy+sPwSYFxYVCiXuzeLbrwIeQKw+Z88JfPiI+y2CAx0J/GXgVdTVqKjEmFHJsxVg8//F+c2x7piMooMvipJalg0VZWknv1tSGzQ2ZGNw7d2ycFZmoq2Bkb6NfGlPmFjxgZUK1NapBrNG4tPLut3gt/COrSNfoocXl249662786PgMWjXMrSkWti4mKmihUsTdpdWI4Muhs9DaEfvujevcEVlxURbJMvby5neJauu6Kow1pQh5j5FGFxBC1la3NlBSbqQFhfMGJUq62Hu/5ALqHYI7dvwPG0g37UwVfF9WXLCVmPQ6Y+cb90JGoJlieSRjNM4irNwtglB8ivbq/cXelPYg87COp4a2xWHhJVcZMXkevnED1TQubr93RsqaiG1Eg4wRjUwk0G2NDR1tTc0cyPvLdc6l9jXztpM0zqvzWZktMfnvmPy+q/VxQnGdz+pCIVoj+YwFHKV9PiCicbQ8/ITNXyHP+EfV+qFQKC7DzwV4cU/Gb1lQqpWVG3vXz7w6yYFmf9j9SsV5j+H8mIs+LRg8RipKD0Q3o+K6UUUV3LBW7a4ypHApK74ZFfmlzkn3QJfZQHKTcvHlPQzlo5Y13ASdOFbznTLbU3Vx/+9kVe5kl6SVrUPr36DD6jwBRnKCLyUNbSNveZuo8UQvZi+7JLNkRfgcHM1RxagPCgir7bsW0RDgH9aAZzVauIcJBISKu9PdC9Uid3m3rxVcK9hEnka1anBEXbC/Gu1MT46kUq5EuLpfjgq3la/2qpZX6PboPqfq/TUspcL1VK2v2nMJOUihhSs0ucpV2jJG49lxObSCgeC2bLolJR2W3bJV5uK3huGVO9oWZMLy27araJ7LmPuKvEOLy7DiwQ+gCVA9/kEtGeW5MWmw6sfdZ4Cb89O/RBpPKYYVbjyL85Cr1xMZ5m+/lMt+QUnxkNd53+SEAP/U+EBRC56PebdF01CiabeRyP6qP8adfcfHfGR70ImadzoXSm0TYYUoKiqu8reTljuKl0zlUBbn+NlW0ZbQVtGB/Kklwu6fLC332VnGSUIcbVFhlWBVrJv6OcSVGOLmniRdHRl6ObRUOumw92pPXk9GUHmIrqyd66GrkD7TVvPL4sfLcG9R79NR+4ka6ZQT0zSpuay0oCYLSnwgVHxe44qKK12TpqfgZH6fNt8+b9qPQCDAuWrvUAfns8+MMvTg+/M36eP4sx/cJQOROvP98o/WHvmky+Jl01SM0RQu06kW0ixXyPb8Fu2gOzvza+W2MsD7JutSD1texGqZkxVB2tPr7+VjvQRk8bITQ3JswOj+/GqBI9U+wENTuMyY6qNOSfVgOahDpuCdZaq9uMra5uLSmiaoqKuqoa2wqKHj2gPOsgBPOHPaTlVP2RuWSUQ+yh67MzW+xtQWas0/NTQepteHhZCF+rVHpvYJuPIf9dbCzH3j1MyUS/FtFdlX+1MhrwW4sbdfGLZTW/nc/XC5hpOtRUkUfkcjvcDo1Ly4yM7rGdc66mEl2ktf9nerblkpnoqPvKCvreTp11tnWvfYLKS1+Qq2Rjc8RC1JMymoPrawoDk26GoynqHB8LsRw10ddeuOTYCvzZkcxYs5QoEkBwrJwoFS8FzBAGsdn52cEtvbnFLQ2AwqNB8/f7wn2BDgLIXTI1/XZbOI8pfHG6sFRqJQuSmf+03uT0FoAouMdV36b6ssfObQhx6LJAC5JOjRJ98RGpcOD2DRAQhya5724k8jD1h4LdidXlqFLf0sZHAuMoKD7AbsKt/0fd4/Vp3avNOQvtoYn3DQzIES+xSyatElnBRBl1EIxJbWQWNi6qCzRibfNxMqaOHTB3rsnzAXrlFKTk+Ij6npLznbZWQ9NHDQmMgeOSuV88kaWBdCjj8xcdAY+BGzkwpH7WRlK8dIdm1sakRKxZIVFUseqFiypmLJtqXBUOs/VYN0qxqkxdbQZDKinSjANtY0GVCNI2rW+QYwu3FzxP1tJrTwsMA9gQs8xgrXQUAg+piEBvc8AO9TRYB7B82uA0zKTvY9aVsiO7KMAXVr96Fvy3o5pLZl2cal7G+TUyFVKplYB8jK7gGyckCArJxkO4aSctWRmAcc7Z23QFeOs50JRMxy9qL1vQEsIWcX8+oHYP5WWo+9VD6nMDiLc6JPLoYrq2ZpweFL4V8lNE5YC4TiNRrdxrq3SZ45Yod7VSuQtwW8h29WD9RD9b36Qf2ofOoENGaJvLi9evlnscbfzfoKezWBi4ALpm9MFZ3GrBj76YeKhcuttl0XEj+tLt+hSGi9rYo30M/p7eyA/mZncQGG+fvzOIB+1KhaU7Eq93cnn/2sRH/GKclAHTBq1HryTc8B8eoWlUbzLlRPPfgx3OU/MvJRPjN91RHLfjqMCqMqVOxQbpH1YQlrhhabAAPqR2x0NtgHGNRn9ocodjiDWYl8D5aI5mxIDwAF+9rUCsQj/UhMU5U3VJcb+BZcVfymPs0fqIX6TAapZ8NwAACtg67xOwwCAw0T4LOrgnRo2wn4dkTc4jenXTU1PcGo7iuLM0qssQ2rItpq23y6rpi+xag4S7c9CdQAwHbtWVoNAGyRVTneWQiZm339JuEK2sXY7CVskr7XR2A11BempA0zJ7tp82vRP4R3iHAcG24evvJawFAFpj8UU9a6hj0EOBHtUkfMSiAthb3s8eg+1CU3iDaglTAmFQQrrIoZTf79qy+L347/dZpcBXHcIOVjkUUiWOl0X/euKL6KbNpI0NO8oGlkqcM0DXzkF0SqhkFba9VgtBv81xAHBlwEotPBK/km/UUdTbREmhlfUCARF12oGgDiZi0aBVNXh8M5J+lxPrDFdgLelkQndU26kql14QNWIDYDHMz22q3XfuV8zGCrG1e7ju7z9OZmW/xU6KRYf2n7vLg6PY6rggg/TnDCYN5ArVLRMszoi8RbvRidqBT4QRwDzbwejOvaA+FBu/snkevL36NLw0A2JSp/ZYtzXlZepEJbPG2DYoG6MMfnzY8lvR3kVohZoZs02MbZTTy0J2kUXe4iQpFA6/Q16/CHEAeSA0luC4oNhVkZSSJiWi2VzxorYN57xglrecSfIibcqwd2fIP0eMnHCOQRy92EjVPodQgCwvzBW3ZbRMeVBCtgkb0M7Iei0Yi2FSZm8KbHyNqxyMi82eCSNUMSaGykSeYom5c7tIEMVY/sbfxiB67p0EWdWBq5/i+hGD/pr3gY4jd9PpjHP/uPmyv8H6GoG/T5oZw3Ps1IjQoU80yVZ37C1NV3UJfbAZSlXdCInmskDUIG5iCLED5MEYmf/rgHy3VbNS+AmggWloUyyTmOItrE5/stmvFhYNPM6lxeTRjdPPU9Ve/Xr1ONggA/sCPoQE0wap7mMKPbAAFViIk/Bn+Ji7S3S4VXu36PTnlCUSsEYtarvpLFb1/F+Mndb+5ixD/v/rXnpCdkFWl3H8FejWJ/fuaXCuOUgV9e1n5WlZeMGASEKZXMUj8qy6RfDN7yRZKeQR+xi+8yibpBMcWr8JYneBRZo9cbECHehUqo80BiYNtw3omjF/M5s0eldajzCASsr5hcK0s3l1DTt299pdvGArEkDIs7EA/vccNVIi6c0wZOn7qomzJHjh584UG0vhu30+Xg8sRYOCbbb+I24mZnZiS1ZEXSkqT+AgWqJ4Fupjk1CV6/3y5bI00QTtfgd9cx/rn/1z6KHOnf1Y8z1V4I6rOuTndX4yf737w6yZ12vbkplXB1hSDFElpngPZrfI41eEFXYQGlc5tFNnefRLYSPXaGYW486eSiQXf60ppav6xjvNXfMgx+SdRyf0ogZjQZW2kNG3/CqxIhfqKYUISB9yxO6vkkRJXZrmTN20AiQlVPRv/1KcY/p39NMfh4iszrpslz/FTZ7DFh6iGzpfyEZNnAQPkVwDZkF6UiL/RjQtnzZZZskEDOAQDbucuWakJBarN0DFEswgS6puuQkjT7t9PbGAgPyEMnp9c40oOYitlqBHTIm7ri2diq8gUZsxUBABwGP48Zkes1fCDQmuYoZGI3hx5TNxPNd+AqXfY4BgvTgxEgoCmGMK96kGiQz0kNRYImgcl9sCG6KnlfHTG25icamjVDYqhmQEaktXTBd/FKA2WlO6tPEM63D0Mw1sYVMj6CU9MByMFCJZmy9ONZ/2FO4krErkh8EohWk2YGh4BmWzYrUqq5qK0yHE3cSQEirOm9EQa0HspGbztwhVogYVNX2agNVayCCXzI6dToMLnUBJJPJBMiB97JhYJ0ttozI59rfmCuRwz2CJLZFE7SyE70Nkh4gGObrr86QH6MKUqJLEps54zAyQriWuTRI1YCLe3zRcA4brrrp3CIodramAkf74v6besCbEANNKb1BV27bPiL3GkE1T7fLwXNlSEFltuYuICXFqGKyvtponxPoLfPKBh18MKFNDNWrJqsTOZpatqKYba35CuQpmRQL6+IWOfOIWdUfMDQ2oxA55NTAwcvkr1mxIlVk5EibFF3xrQGhxBy3sIUqhX0uNoYp+bMKOGg9gQfb7/MzYg6J+dtswyVSgmpYp7i906F1i0ZvNcLwfyXkURqI02FTvdEeeJS+7OtE9rjY8zqKCNpJmjyDYQ1u5I0D+JNE6j1qkKNvxG51x6NFHpW+LgPIRjoLhgKMOPA9CiwwtN0xAFuQoAaRDhvboQPWZIM1aQeEGkUgDyEH1nrNEAi6Bj4bxDNJRVmvRVv2f/cZ0E0hXQraGuymPpjlrnAwZ3cC5NwATly11GKZe6nsKZC/AAhapzlE5jQnhIAsMvBnvAOZ1jgbH3DyGmZbWXhK3pzilyyDMGdATrMCdTzjJQl0Mu51xbWbSYyIMSMCDasp6L6cDpqIO4lbN3EwTk3syQfRW0853SRLZNESl7vAV1E6qMZqjvdLHCjxPgadwWtRU+i7STHzMPlyrSdutoi4o0gVYln+YqYZbtso3X/nvPoPCWbTw/REtGjhHvTgoBp08sOJfi6RyoJYr/1VkfRvTgq5oZfzo+hWNALurvuKI6hWFDrqk36LKDqSo9rKQWrwCVWWdlDsLupSMl76ImTidyOTgydSOJNQ6qcWdnkMSMLvvVO6ahaZ7qmzAy3sNAk++WwKtDALiapLxRE1pwZ4qZplJmpFxwHfpYerT6CrTdBsVrbu1UU+UJjMCW+Vg6LIzGhEONsgsYJ6+ZbqhWhHsSrWeZZDtkNtu7rIi9ZWAryVCD4TMyq4f08VRjWjQJLI69T+Hqf/bpiXjtgrt/5ecxCvnwuvOg+6oG/6c5WNFIc+XuIxHsz3pacO+WYs0sxKyUilMdIQ2IUgswYswx22sOMt7cwbqKb1T1DACGa9BFHgvTIyB8B52fGatpzOq8pqw9jfnC4MC8/ZnPYQYsPs7tcNzku1D04GaeqJ3mU+FrPrhO5TkaPegxct64bPIoftcHbj/aknz+IDs+JBtS1qgO1uwOUL+lUaWMPJFh743rtHC0Gtku6bk+K8186VZ+x7QzYA0aDKiiTsgmlrJ12zwF08UHrccnFlLaP1EFW6IcqvdlT25naG+TtWYVILHQeF0dn4yOXBYV8RV4hlnarpoxa18g0MhMT+/05Rpgb8wQ8HOdbX3wYbTj7ptPhNCB6buuq6r48e3tdySigrBf+eoeA1ewHVR1yo5H1xTe7FySZKcbxP1hpzVatlSCavkx5CbAEvmSVZlYqp4mj1HnFxLpXwF0oHN33tvFkA2kzRY16Cqqr4JHQX2L1EJavoR/ycw/nyzd7a+82nuSFs93xHnp7mMj+PRKsZMrYfbcWy0zD0iSobukzVvWMZdVHwVw9mzATpBBJ/v/Sp4XW+7ALt/ALTiEwxIdsf9G/4z/yX4Rn4SD8bP7n6WP9e+2/o/ukeadasse2NvyCter3eqM6vFnz8Dasg2z68BEQiIDiKeVbXp5DlBEbB8ZJNzqZE4Yua4uXrDacLiIw/OUD4A6gArxs2h3b3DAzyK0uKXsc3H9nNZba2Hp3dqsUI/og9P5jiqbO1eypeVkTIa4xXBOtuuZtmzo7vGOOzUt1ejzcdONq/uPiqHrl+magzlezpDOrUqLcCMISrsCG7dIqJOR+bphhe3sdC++i66vZsUEqSC6AmF08/5f5ZAbivEoRDPXKlHmATCVmdKdEAz5TFlU+ySa4t+ZtaWIKthcULB/Y9dIhVqUZyGlFySmUuGa+owzQ/iK2wql3Bo98+BY3my21qVqfSVmmpB+rW+WDYInaJBXupw56Kq7vhOOwpDo/HkbpGhxFOqZI+6pPvoEBfhg8KQSaGcKLHso0uUeykZ32I5rLXU/vaJ3If4Jmeb9+jw1SU57lmvWc5fiZOuryOMe1i6IcHw6PH39MHh71ZGCt8RseItzZ8qTq2XqdwE83TSN5CIFpzWnTuadN5M5QnaZfyc02m8sWbnBDN/+DON0cXiecj18jbhMdZy76FFJixiWzAfnDUDjVY+t6RkSNxzlmF7b27NywoHDWdYp6IZElPB5OT1ZQIyyct+VZKhuf/OCZBPsuJ4+SqKEhHLdz9C7+ZTwejk+UafXTGIbpuZxmywdEGP6SwdUWX2zCE1kbbz6Y4+gNRFLRZAuihTsuCDay76qmUco0TTXhKQ8NmkY1pOFyOOgO0HpCq4QCueuCehkjF3dSTSURf+6fYFowx2z2S2Bypx6myhBqtDCdZv/yZJWs26RQK04+io8EB6uyx5k3BkbRrQenybJOCp+rP3EMaQK4WnQi6vgw3aVD5O7gr0GoOEjY8y71cHN2vNW8eRZd+ib3ZuQiQOLf5TE6Puc1wCi6e9VQLA6E1gEooi1xCjnIXPA9q/5IAtfdvIkwSOLTcH/fjf5ErBJx6cRcOBV0IAQFPf4sz//ni5iS3gDkKxDSG2VSO4VJaoJ88ShojWqQ1ISNC0k91Sq0SaXsuJfSTVnzSf7RH0QSySk5itgFzE3oyZsEmnBqEN7r7OWi9H439cuapEW6E6T0rir+eBcNeFyShzLqZAa7DrYPn68sXZ7iX2wH8GqOYP5GqsyOchrIF01DO1HX6gWjppdtlTkFEpGbIGgrQ1cEyq5E9blJ0pxJZAIypSlOMqzRkgs4baNO9MEW24t8zROmZJAO5skjHtXoO6Pf+SngTyOdfN5XlRiWpQOEGNiRbEDXvPGJIIF6BoEIWT6TcNydrGhrH9JRF0s5ir0sFVqp5I7C/WB/iM9pc9kv38Su7Wvrai93zkxQ+w8TxDCOxzVcFF/kHLvx7h1nhzwT0Tyl0RGiOdmu48X4RHmJVpg9owKHspWzpTcsh1ve2TLi0japT5BXq7b7WJ2uhEJH6GpWoLpQVnVeYb2ybmyI0QhAdfQ2jAHNRFiZjyKbUYIw1H2qANWBLSUz6YyOcNQmit+OwHg88xoYDz2j89HVvbv+13jfGCE+7t7HGNSGuMVBQ2zuuvje2orTcZg19nLKLZvYmngZh9wFqhf4a6fVKH+B8aahgc2FNfOLHQ/jYVtjmjOYpRFgxiY918BC9v99fCF5rcJQ8crJDwqEEUR7g7ONBxiYR+Tz9L47wEpiyMeNxKn08VgmbxBN1MKTX9ESiYsHb2qPCD55lvP/6UbRLJPVBCozSOUUXK5ij52lyxqXW8yM32vCwzLVy1cmDHhDiOom7AsB/tmr+AeGsTR4SPaJjvvlM35lrzL4GXt6QVtmEqfz9n7toW0smhE7V1msHIEbQvvKrlVorKjdluo3BBEBAXK1Rd/6+zs+9lfrd06ZOQDgjZ8EDwD4KGw/LlX/53xjTgQIJxiAAMazZl8AzNliqpoqxg2QJ0znLy2HFxpiNi2SG0jIQno1ZZ7ucvS+y7XrIYQZ3VyUkCvOtFoS5UIjvkquiQtJssT8Xb6kmq7ALdgE62E17I+9sDZ2fbrt08DlPE6jhKhWiYySFdt+6sJ4lln3wNGXk9y12Hes5EoyyONu9AguvUVyUpRWrDNdWEOU6AhDdW82mVaeXQq70E9lHTCuLzrTjUR2TRzDZLV+jEh9Fqw+Q0oNsc0NyG3wtYvItyJQPkClTBnVVaElz6CSGRQZMV+SqkLGdYlfyghO4amuTISmjMThvdCK519MBiEorT4P0FuKeg7gppctHnz9O5Il5FghwIdg02ykmOy6MrJdUYDsz/QOkqqSZ03w7FlsyhR3lqTOgd7uchlM2Ldcme2vvctfYg3csgXT2iQkljnH/Cm15u4pZgvvei+7HTBLfzl5god299Jbq+j218F9lPcgym6I4WKlseRr0snxCrDzoJ+DsAI4023NqHrq6ezqNtOhWi1ySo9+T+GsV4aO3l9L67zSJV+jSg4TDBScg1XUmFSaWqswq6cbnVVVyQ6rR+8CupXK4DysCoB/rbAl8Dzj4xi3UQ051uHbD8Vnu5j2RFQJA3EvAH1BFYOE4HjFj3KP45cMmi5GM0ZsGgzytfR+IO2+Aveh1yATBWUA61ZIOn8KV+UcO5/IClcMMGcL9ABAfU24dkiNwdOx+b/UcDomYEWMw8bYxMb6pjfMnyLAvchMYBEYggB/McDGAAIEYEEgga/BQYCFzTwObLpRjiP7opqSEHBTGh4aG9d2SodiZA6IOFTjn+PR7F9zAcfIoadAeO1PgeH0fQqciD97RExhcyqEp7ATCfyF+NmFdZZfKI/PP5zZnK5ZETn/oVrZeZ3/j8Drn7lO0E9ax/uCa4Q+sECvcr5UaXSOYjX2KLlQNnco3ZwlMlE21KLMoWLIMb/wt8gauYcPpwgTFJPyIJ0hwCkrKlUTOAuUadSmzrhCyPLm6IDtyDlA+pan8hvPEzlPkT94lEQ4wOMz2pRBhGvJe4jnQ0hSPc53VTR0otm0EVaRg6o1l2baChWJ03ki5kw5EqzKozx6rg3JVCTKe+Mr2FqZmNm7mMlVmiriCRhzhNMAXrb1FxAZLQo8Y/ubjBMXbjx48eEnAEmQEBRhx4gQJeY4cRIkSZEmAw1DlpwTTjqVxzj3PHkXKLiYbkQ5p7Gp5qRGy9Zq5erRZ8CQ0b2HiSTmOjbN3IIWLFmxznn8r4QdCnsOqBzROKFz5sKVG/dg0yBVmhFldjHlyXZDm8Zgl+WpFMXBEXPkKpfhnpfBpVq7b776rl6X+2Z18+CpgJcHvM2Zt+ihfyzY42PVkmU9fH1SaN2aR/wceC9TAH+BggUJUStUGIZwEaJEihZjX6xL4sS7LMFNda5IlOSqQx/ctoGlN7g99sKT4In5YwF9+g0ZNmXAoGnpOoI/FjJqzN1AhqAcT/krBnIKSipqGja0dPQMjEzMbNmxsOeEU84456Lz+fIJFovF4otup8wo71rT5aBRMWTHxmWoFdIaVh5PoDz+ALXVMH4pv269ZCHnHr9Rffq0i7CTms/mc8U4Nv06TORLwSXeNB5HirpIbPQBbnjAB21vQUzzWeVSb5SoK/Ges11vyI/c5/wOKInOASXTOXm4j4n8KADPG3pGd5I/IUE2KE3HjwFrDgBA73LwAQeAA7qPcENlrgRXDqS1nftE97fSXo3E1Sd++831vFWLEHcm+u23HzfLTOwLfz4uhpmSk3TQLGf4Wy8uZ+SZxO3hyqDeIp/sqZnUhz9uLocz6H+/VfuZ934Oo+2doHTXEtyzTPJD36Lnhym+hT7VuvGm4ig+DuWbKA5TvFf5pHKn/ED5P5p0srKhDVDvmifGJ6GtYS3+CjT5io9r5U75jfJ/8SZKdWzFJ1EVZ3b0Zy8BAA==') format('woff2');
      unicode-range: U+0000-00FF, U+0131, U+0152-0153, U+02BB-02BC, U+02C6, U+02DA, U+02DC, U+2000-206F, U+2074, U+20AC, U+2122, U+2191, U+2193, U+2212, U+2215, U+FEFF, U+FFFD;
    }



      /* GENERAL */
      [href]:focus, [tabindex]:focus, input:not([disabled]):focus, select:not([disabled]):focus, button:not([disabled]):focus {
        outline: 2px dotted #aeb0b5;
        outline-offset: 3px;
      }

      body,html {
          height: 100%;
          height: auto; /* IE 11 Fix */
          min-height: 100%;
          overflow-x: hidden;
      }
      body {
        margin: 0;
        display: -webkit-box;
        display: -ms-flexbox;
        display: flex;
        -webkit-box-orient: vertical;
        -webkit-box-direction: normal;
        -ms-flex-direction: column;
        flex-direction: column;
        margin: 0;
        background-color: #fff;
        font-family: "Roboto", "Helvetica Neue", Arial, Tahoma;
        color: rgba(27,27,27,1);
        font-size: 1.09rem;
      }
      main {
        -webkit-box-flex: 1 0 auto;
        -ms-flex: 1 0 auto;
        flex: 1 0 auto;
        padding: 20px 10px;
      }
      @media (min-width: 480px) {
        main {
          padding: 20px 40px;
        }
      }

      @media (min-width: 992px) {
        main {
          padding: 40px 83px;
        }
      }

      .bg-primary {
          color: #ffffff;
      }
      .text-white {
        color: #ffffff !important;
      }
      .container {
        width: 100%;
        padding-right: 15px;
        padding-left: 15px;
        margin-right: auto;
        margin-left: auto;
      }

      @media (min-width: 992px) {
        .container {
          max-width: 980px;
        }
      }

      .container-fluid {
        width: 100%;
        margin-right: auto;
        margin-left: auto;
      }

      .row {
        display: -webkit-box;
        display: -ms-flexbox;
        display: flex;
        -ms-flex-wrap: wrap;
        flex-wrap: wrap;
        margin-right: -15px;
        margin-left: -15px;
      }

      .col-12,.col,
      .col-lg-3,
      .col-lg-12,
      .col-lg,
      .col-xl-auto {
        position: relative;
        width: 100%;
        min-height: 1px;
        padding-right: 15px;
        padding-left: 15px;
      }
      .col-12 {
        -webkit-box-flex: 0;
        -ms-flex: 0 0 100%;
        flex: 0 0 100%;
        max-width: 100%;
      }

      .list-inline {
        padding-left: 0;
        list-style: none;
      }

      ol,
      ul,
      dl {
        margin-top: 0;
        margin-bottom: 1rem;
      }

    /* SKIPNAV */
    .usa-skipnav{
        font-family: "Roboto", "Helvetica Neue", Arial, Tahoma;
        font-size:1.06rem;
        line-height:1.5;
        background:transparent;
        left:0;
        padding:0.5rem 1rem;
        position:absolute;
        top:-3.8rem;
        -webkit-transition:all 0.2s ease-in-out;
        transition:all 0.2s ease-in-out;
        z-index:100;
    }
    .usa-skipnav:focus{
        background:white;
        left:0;
        position:absolute;
        top:0;
        -webkit-transition:all 0.2s ease-in-out;
        transition:all 0.2s ease-in-out;
    }

      /* HEADER */
html {
  box-sizing: border-box; }

*, *::after, *::before {
  box-sizing: inherit; }

.ncbi-header {
  background-color: #20558a;
  z-index: 10;
  padding: 14px 0 10px 0; }
  .ncbi-header a {
    color: inherit;
    text-decoration: none; }
  .ncbi-header a:hover {
    color: #ffffff;
    text-decoration: underline; }
  .ncbi-header .ncbi-header__logo {
    width: auto;
    float: left; }
  .ncbi-header .header-button {
    width: auto;
    margin: 1.5rem 0.3rem;
    background-color: transparent;
    color: #ffffff;
    border: 1px solid rgba(255, 255, 255, 0.5);
    font-size: 1.4rem;
    font-weight: normal;
    white-space: nowrap;
    padding: 0.8rem; }
    .ncbi-header .header-button:hover {
      background-color: #0071bc;
      text-decoration: none; }
    .ncbi-header .header-button .fa {
      margin: 0; }
    @media screen and (min-width: 600px) {
      .ncbi-header .header-button {
        font-size: 1.7rem; }
        .ncbi-header .header-button .fa {
          margin: 0 0.2rem; } }
    @media screen and (min-width: 1201px) {
      .ncbi-header .header-button {
        padding: 1rem 2rem; }
        .ncbi-header .header-button .fa {
          margin-left: 0;
          margin-right: 0.5rem; } }
  .ncbi-header .desktop-only {
    display: none; }
    @media screen and (min-width: 600px) {
      .ncbi-header .desktop-only {
        display: inherit; } }
  .ncbi-header .account-old {
    float: left;
    display: block;
    font-size: 1.4rem;
    position: relative;
    width: 30%;
    text-align: right; }
    @media screen and (min-width: 600px) {
      .ncbi-header .account-old {
        width: 30%;
        font-size: 1.7rem; } }
  .ncbi-header .logo {
    width: 245px;
    margin-top: 13px;
    margin-right: 10px;
    display: inline-block;
    margin-bottom: 5px; }
    @media (min-width: 375px) {
      .ncbi-header .logo {
        width: 280px;
        height: 42px; } }
    @media (min-width: 640px) {
      .ncbi-header .logo {
        width: 414px;
        height: 63px;
        margin-bottom: 0; } }



      /* MAIN */
      /* Title */
      h1, h2 {
        font-family: "Roboto", "Helvetica Neue", Arial, Tahoma;
      }
      h1 {
        color: #205493;
        font-size: 6rem;
        line-height: 0rem;
        margin-top:2.5rem;
      }
      h2 {
        font-size: 1.6rem;
        margin-top: 15px;
      }

      @media (min-width: 480px){
        h1 {
          font-size: 8rem;
          line-height: 0.5rem;
          margin-top:3rem;
        }
        h2 {
          font-size: 2rem;
          margin-top: 40px;
        }
      }

      /* Content */

      @media (min-width: 640px) and (max-width: 991px) {
        .flex-child, .flex-child ul li {
          text-align: center;
          margin-right: auto;
          margin-left: auto;
        }
        .flex-child:not(:last-child), .flex-child ul li:not(:last-child)  {
          margin-bottom: 20px !important;
        }

      }

      @media (min-width: 992px) {
        .usa-search {
          margin-right: -5px;
        }
      }

      .usa-button{
        display: block;
        margin: 1em auto;
      }

      .usa-search {
        -webkit-box-pack: center;
        -ms-flex-pack: center;
        justify-content: center;
      }

      .usa-input  {
        height:2.45em;
        width: 100%;
        border: 1px solid #666666;
      }
      .usa-button__search {
        height: 2.32em!important;
      }

      @media (min-width: 480px) {
        .usa-input {
          width: 60%;
          max-width: 300px;
        }
      }
      @media (min-width: 640px) {
        .usa-button {
          display: inline-block;
          margin: 0 1em 0 0;
        }
      }
      @media (min-width: 992px) {
        .usa-input {
          width: calc(100% - 92px);
          max-width: none;
        }
      }
      .usa-button span{
        display: none;
      }
      @media all and (min-width: 480px){
        .usa-button span{
          display: inline-block;
        }
      }


      /* FOOTER */
footer {
  margin-top: auto;
  letter-spacing: 0.5px; }
  footer ol, footer ul, footer dl {
    margin-top: 0;
    margin-bottom: 1rem; }
  footer .social_media a {
    width: 35px;
    height: 35px;
    display: inline-block;
    margin-right: 5px; }
  footer .pt-5, footer .py-5 {
    padding-top: 1rem; }
    @media (min-width: 992px) {
      footer .pt-5, footer .py-5 {
        padding-top: 3rem; } }
  footer .bottom-links {
    margin: 0 auto; }
  footer .bottom-links ul {
    list-style: none;
    padding-left: 0px;
    display: -webkit-inline-box;
    display: -ms-inline-flexbox;
    display: inline-flex;
    -webkit-box-orient: horizontal;
    -webkit-box-direction: normal;
    -ms-flex-direction: row;
    flex-direction: row;
    -ms-flex-wrap: nowrap;
    flex-wrap: nowrap;
    -webkit-box-pack: center;
    -ms-flex-pack: center;
    justify-content: center; }
  footer .bottom-links ul li {
    padding: 0px 8px;
    position: relative;
    font-size: 18px; }
  footer .bottom-links ul li:first-child {
    padding-left: 0px; }
  footer .bottom-links ul li:not(:last-child) {
    border-right: 1px solid #FFFFFF; }

@media (min-width: 992px) {
  .col-lg-3 {
    -webkit-box-flex: 0;
    -ms-flex: 0 0 25%;
    flex: 0 0 25%;
    max-width: 25%; }
  .col-lg-12 {
    -webkit-box-flex: 0;
    -ms-flex: 0 0 100%;
    flex: 0 0 100%;
    max-width: 100%; }
  .centered-lg {
    display: -webkit-box;
    display: -ms-flexbox;
    display: flex;
    -webkit-box-pack: center;
    -ms-flex-pack: center;
    justify-content: center; } }

.icon_social {
  width: 35px;
  height: 35px;
  display: inline-block;
  margin-right: 5px;
  margin-bottom: 1rem; }

.icon-section {
  background-color: #dbdbdb; }

.icon-section_header {
  background-color: #90a6c7;
  text-align: center;
  color: #fff;
  text-transform: uppercase;
  font-size: 18px;
  font-weight: bold;
  padding: 16px;
  margin-top: 50px; }

.icon-section_header::after {
  display: none;
  content: "";
  border: solid #fff;
  border-width: 0px 3px 3px 0px;
  padding: 7px;
  -ms-transform: rotate(45deg);
  transform: rotate(45deg);
  -webkit-transform: rotate(45deg);
  margin-left: 15px;
  position: absolute;
  margin-top: -2px; }

.icon-section_header.opened::after {
  -ms-transform: rotate(-135deg);
  transform: rotate(-135deg);
  -webkit-transform: rotate(-135deg);
  margin-top: 6px; }

.icon-section_container {
  display: -webkit-box;
  display: -ms-flexbox;
  display: flex;
  -webkit-box-pack: justify;
  -ms-flex-pack: justify;
  justify-content: space-between; }

.icon-section_header.opened + .grid-container .icon-section_container {
  display: -webkit-box;
  display: -ms-flexbox;
  display: flex; }

.footer-icon {
  display: block;
  width: 40px;
  height: 40px;
  margin: 20px 0; }

/* Added after adding USWDS */
.bg-primary {
  background-color: #20558A; }

.icon-section_header {
  background-color: #4773aa; }


      footer p {
        line-height: 1.5em;
        margin-top: 0;
        margin-bottom: 10px;
      }
      @media (min-width: 992px) {
        footer .pt-5,
        footer .py-5 {
          padding-top: 30px;
        }
      }
      footer .mt-3,
      footer .my-3 {
        margin-top: 10px;
      }
      footer .mt-3 li {
        margin-bottom: 0.3em;
      }

      /* ADDITIONAL NWDS OVERRIDES */
      .usa-grid{
          margin-left:auto;
          margin-right:auto;
          padding-right:15px;
          padding-left:15px;
        }

        .usa-grid::after{
          clear:both;
          content:"";
          display:block;
        }

        @media screen and (min-width: 600px) {
          .usa-grid{
            padding-right:30px;
            padding-left:30px;
          }
        }


        @media screen and (min-width: 992px) {
          .usa-grid {
            max-width:980px;
          }

        }

      .list-inline {
        padding-left: 0;
        list-style: none;
      }
      .list-inline-item {
        display: inline-block;
      }
      a {
        text-decoration: none;
      }
      </style>
</head>
<body >
    <a class="usa-skipnav" href="#main_content">Skip to main content</a>
    <section class="usa-banner">
      <div class="usa-accordion">
        <header class="usa-banner-header">
          <div class="usa-grid usa-banner-inner">
            <img src="https://www.ncbi.nlm.nih.gov/coreutils/uswds/img/favicons/favicon-57.png" alt="U.S. flag" />
            <p>An official website of the United States government</p>
            <button
                    class="usa-accordion-button usa-banner-button"
                    aria-expanded="false"
                    aria-controls="gov-banner-top"
            >
              <span class="usa-banner-button-text">Here's how you know</span>
            </button>
          </div>
        </header>
        <div
                class="usa-banner-content usa-grid usa-accordion-content"
                id="gov-banner-top"
        >
          <div class="usa-banner-guidance-gov usa-width-one-half">
            <img
                    class="usa-banner-icon usa-media_block-img"
                    src="https://www.ncbi.nlm.nih.gov/coreutils/uswds/img/icon-dot-gov.svg"
                    alt="Dot gov"
            />
            <div class="usa-media_block-body">
              <p>
                <strong>The .gov means it’s official.</strong>
                <br />
                Federal government websites often end in .gov or .mil. Before
                sharing sensitive information, make sure you’re on a federal
                government site.
              </p>
            </div>
          </div>
          <div class="usa-banner-guidance-ssl usa-width-one-half">
            <img
                    class="usa-banner-icon usa-media_block-img"
                    src="https://www.ncbi.nlm.nih.gov/coreutils/uswds/img/icon-https.svg"
                    alt="Https"
            />
            <div class="usa-media_block-body">
              <p>
                <strong>The site is secure.</strong>
                <br />
                The <strong>https://</strong> ensures that you are connecting to the
                official website and that any information you provide is encrypted
                and transmitted securely.
              </p>
            </div>
          </div>
        </div>
      </div>
    </section>
    <div class="usa-overlay"></div>
    <header class="ncbi-header bg-primary">
      <div class="usa-grid">
          <div class="usa-width-one-whole">
          <div class="ncbi-header__logo">
            <a href="https://www.ncbi.nlm.nih.gov/" class="logo" aria-label="NCBI Logo">
              <svg xmlns="http://www.w3.org/2000/svg" viewBox="0 0 2039.55 243.26">
                <defs>
                  <style>
                    .cls-1 {
                      fill: #fff!important;
                    }
                  </style>
                </defs>
                <g id="Layer_2" data-name="Layer 2">
                  <g id="Text_outlines" data-name="Text outlines">
                    <path class="cls-1"
                      d="M266.77,67.24V176H248.18v-49.2H199.53V176H180.4V67.24H199v43.19h48.66V67.24ZM161.26,176H142.68V67.24h18.58Zm-37.17,0H104.41L55.76,96.21h-.55V176h-18V67.24H56.85l49.2,79.81h.55V67.24h18V176Zm208.83-54.66L266.77,0H21.87A22.05,22.05,0,0,0,0,22.41V220.85a22.05,22.05,0,0,0,21.87,22.41H266.22Z" />
                    <path class="cls-1"
                      d="M283.17,242.72l66.69-121.36L283.17,0h16.4c9.29,0,20.23,6.56,24.6,14.76l58.49,106.6L324.17,228c-4.37,8.2-15.31,14.76-24.6,14.76Z" />
                    <path class="cls-1"
                      d="M428.15,31.14h16.5L485.4,96.89h.25V31.14h14.88v89.25H484L443.4,54.76H443v65.63H428.15Z" />
                    <path class="cls-1"
                      d="M571.15,106a7.54,7.54,0,0,0,.69,3.75,2.9,2.9,0,0,0,2.69,1.13H576a9.16,9.16,0,0,0,2-.25v9.87c-.5.17-1.15.36-1.94.57s-1.61.39-2.44.56-1.67.29-2.5.37a20,20,0,0,1-2.12.13,13.78,13.78,0,0,1-7.25-1.75q-2.88-1.76-3.75-6.13a25.29,25.29,0,0,1-10.44,6,41.17,41.17,0,0,1-11.94,1.88,29.25,29.25,0,0,1-8.37-1.19,22,22,0,0,1-7.07-3.5,16.81,16.81,0,0,1-4.87-5.87,18.11,18.11,0,0,1-1.81-8.32,19.18,19.18,0,0,1,2.18-9.75,16.27,16.27,0,0,1,5.75-5.87,25.79,25.79,0,0,1,8-3.06,90.4,90.4,0,0,1,8.94-1.44,70.49,70.49,0,0,1,7.38-1.06A34.66,34.66,0,0,0,552,81a9.49,9.49,0,0,0,4.25-2.31A6.37,6.37,0,0,0,557.78,74a7.28,7.28,0,0,0-1.32-4.5,8.78,8.78,0,0,0-3.25-2.68,13.68,13.68,0,0,0-4.31-1.25,34.25,34.25,0,0,0-4.5-.32,17.93,17.93,0,0,0-9.87,2.5,9.74,9.74,0,0,0-4.38,7.75H515.9a21.45,21.45,0,0,1,3-10.37,20.76,20.76,0,0,1,6.69-6.63,27.57,27.57,0,0,1,9.19-3.5,55.13,55.13,0,0,1,10.5-1,44.65,44.65,0,0,1,9.37,1A26.74,26.74,0,0,1,563,58.26a18,18,0,0,1,5.94,5.82,15.93,15.93,0,0,1,2.25,8.68ZM556.9,88a17.36,17.36,0,0,1-8,2.57c-3.17.29-6.33.73-9.5,1.31A30,30,0,0,0,535,93a12.93,12.93,0,0,0-3.75,1.88A8.22,8.22,0,0,0,528.71,98a10.78,10.78,0,0,0-.93,4.69,6,6,0,0,0,1.37,4,10,10,0,0,0,3.31,2.56,15.17,15.17,0,0,0,4.25,1.31,26.44,26.44,0,0,0,4.19.38,23.14,23.14,0,0,0,5.13-.63,16.81,16.81,0,0,0,5.18-2.12,13.72,13.72,0,0,0,4.07-3.81,9.69,9.69,0,0,0,1.62-5.69Z" />
                    <path class="cls-1"
                      d="M580,55.76h10.75V36.39H605V55.76H617.9V66.39H605v34.5a35.69,35.69,0,0,0,.18,3.87,6.71,6.71,0,0,0,.88,2.75,4.15,4.15,0,0,0,2.06,1.69,10.07,10.07,0,0,0,3.75.56q1.5,0,3-.06a14.79,14.79,0,0,0,3-.44v11l-4.62.5a41.2,41.2,0,0,1-4.63.25,31.47,31.47,0,0,1-9.06-1.06,12.17,12.17,0,0,1-5.38-3.12,10.85,10.85,0,0,1-2.62-5.19,38.6,38.6,0,0,1-.81-7.13V66.39H580Z" />
                    <path class="cls-1" d="M628.52,31.14h14.25v13.5H628.52Zm0,24.62h14.25v64.63H628.52Z" />
                    <path class="cls-1"
                      d="M687.9,122.14a35.31,35.31,0,0,1-13.81-2.56,29.4,29.4,0,0,1-10.25-7.07,30.09,30.09,0,0,1-6.38-10.75,43.85,43.85,0,0,1,0-27.37,30.09,30.09,0,0,1,6.38-10.75,29.25,29.25,0,0,1,10.25-7.06,38.39,38.39,0,0,1,27.62,0A29.34,29.34,0,0,1,712,63.64a30.24,30.24,0,0,1,6.38,10.75,44,44,0,0,1,0,27.37A30.24,30.24,0,0,1,712,112.51a29.5,29.5,0,0,1-10.25,7.07A35.31,35.31,0,0,1,687.9,122.14Zm0-11.25a16.37,16.37,0,0,0,8.25-2,17.35,17.35,0,0,0,5.75-5.25,23,23,0,0,0,3.31-7.31,32.91,32.91,0,0,0,0-16.57,22.18,22.18,0,0,0-3.31-7.31,17.83,17.83,0,0,0-5.75-5.19,18,18,0,0,0-16.5,0,17.83,17.83,0,0,0-5.75,5.19,22,22,0,0,0-3.31,7.31,32.61,32.61,0,0,0,0,16.57,22.83,22.83,0,0,0,3.31,7.31,17.35,17.35,0,0,0,5.75,5.25A16.37,16.37,0,0,0,687.9,110.89Z" />
                    <path class="cls-1"
                      d="M732.4,55.76h13.5v9.5l.25.25a23.83,23.83,0,0,1,8.5-8.43A22.56,22.56,0,0,1,766.27,54q10.62,0,16.75,5.5T789.15,76v44.38H774.9V79.76q-.25-7.62-3.25-11.06t-9.38-3.44a15.41,15.41,0,0,0-6.5,1.32,14,14,0,0,0-4.87,3.62,17,17,0,0,0-3.13,5.44,19.38,19.38,0,0,0-1.12,6.62v38.13H732.4Z" />
                    <path class="cls-1"
                      d="M858.27,106a7.54,7.54,0,0,0,.69,3.75,2.9,2.9,0,0,0,2.69,1.13h1.5a9.16,9.16,0,0,0,2-.25v9.87c-.5.17-1.15.36-1.94.57s-1.61.39-2.44.56-1.67.29-2.5.37a20,20,0,0,1-2.12.13,13.78,13.78,0,0,1-7.25-1.75q-2.88-1.76-3.75-6.13a25.29,25.29,0,0,1-10.44,6,41.17,41.17,0,0,1-11.94,1.88A29.25,29.25,0,0,1,814.4,121a22.07,22.07,0,0,1-7.07-3.5,16.81,16.81,0,0,1-4.87-5.87,18.11,18.11,0,0,1-1.81-8.32,19.29,19.29,0,0,1,2.18-9.75,16.27,16.27,0,0,1,5.75-5.87,25.89,25.89,0,0,1,8-3.06,90.4,90.4,0,0,1,8.94-1.44,70.49,70.49,0,0,1,7.38-1.06A34.66,34.66,0,0,0,839.08,81a9.43,9.43,0,0,0,4.25-2.31A6.33,6.33,0,0,0,844.9,74a7.28,7.28,0,0,0-1.32-4.5,8.7,8.7,0,0,0-3.25-2.68A13.68,13.68,0,0,0,836,65.58a34.25,34.25,0,0,0-4.5-.32,17.93,17.93,0,0,0-9.87,2.5,9.74,9.74,0,0,0-4.38,7.75H803a21.45,21.45,0,0,1,3-10.37,20.76,20.76,0,0,1,6.69-6.63A27.57,27.57,0,0,1,821.9,55a55.13,55.13,0,0,1,10.5-1,44.65,44.65,0,0,1,9.37,1,26.65,26.65,0,0,1,8.31,3.25A18,18,0,0,1,856,64.08a15.93,15.93,0,0,1,2.25,8.68ZM844,88a17.36,17.36,0,0,1-8,2.57c-3.17.29-6.33.73-9.5,1.31A30,30,0,0,0,822.15,93a12.93,12.93,0,0,0-3.75,1.88A8.22,8.22,0,0,0,815.83,98a10.78,10.78,0,0,0-.93,4.69,6,6,0,0,0,1.37,4,10,10,0,0,0,3.31,2.56,15.27,15.27,0,0,0,4.25,1.31,26.55,26.55,0,0,0,4.19.38,23.14,23.14,0,0,0,5.13-.63,16.81,16.81,0,0,0,5.18-2.12,13.72,13.72,0,0,0,4.07-3.81A9.69,9.69,0,0,0,844,98.64Z" />
                    <path class="cls-1" d="M874,31.14h14.25v89.25H874Z" />
                    <path class="cls-1" d="M940.52,31.14h15.63v75.75h45.37v13.5h-61Z" />
                    <path class="cls-1" d="M1010.65,31.14h14.25v13.5h-14.25Zm0,24.62h14.25v64.63h-14.25Z" />
                    <path class="cls-1"
                      d="M1040.77,31.14H1055v33h.25a19.61,19.61,0,0,1,3.63-4.25,22.61,22.61,0,0,1,4.68-3.19,24.84,24.84,0,0,1,5.38-2,23.25,23.25,0,0,1,5.56-.69,30.88,30.88,0,0,1,13.31,2.69,26.21,26.21,0,0,1,9.44,7.38A32,32,0,0,1,1102.9,75a46.38,46.38,0,0,1,1.87,13.38,47.08,47.08,0,0,1-1.69,12.62,32.79,32.79,0,0,1-5.12,10.82,25,25,0,0,1-21.06,10.31,50.47,50.47,0,0,1-6.57-.44A24.4,24.4,0,0,1,1064,120a21.45,21.45,0,0,1-5.44-3.25,15.76,15.76,0,0,1-4.06-5.25h-.25v8.88h-13.5Zm49.75,57a32.14,32.14,0,0,0-1.12-8.5,23,23,0,0,0-3.38-7.31,17.35,17.35,0,0,0-5.62-5.13,15.32,15.32,0,0,0-7.75-1.94q-9,0-13.57,6.25t-4.56,16.63a33.14,33.14,0,0,0,1.19,9.06,20.45,20.45,0,0,0,3.56,7.19,17.79,17.79,0,0,0,5.69,4.75,16.19,16.19,0,0,0,7.69,1.75,16,16,0,0,0,8.25-2,17.37,17.37,0,0,0,5.56-5.19,20.85,20.85,0,0,0,3.12-7.25A36.57,36.57,0,0,0,1090.52,88.14Z" />
                    <path class="cls-1"
                      d="M1116.77,55.76h13.37v12.5h.25a14.47,14.47,0,0,1,2.44-5.12,23.55,23.55,0,0,1,4.38-4.56,22.05,22.05,0,0,1,5.68-3.32,17.13,17.13,0,0,1,6.38-1.25,31.47,31.47,0,0,1,3.44.13l1.93.25V68.14c-1-.17-2-.31-3.06-.44a26.73,26.73,0,0,0-3.06-.19,16.32,16.32,0,0,0-6.81,1.44,15.76,15.76,0,0,0-5.57,4.25,21,21,0,0,0-3.75,6.94,30.24,30.24,0,0,0-1.37,9.5v30.75h-14.25Z" />
                    <path class="cls-1"
                      d="M1214.89,106a7.54,7.54,0,0,0,.69,3.75,2.9,2.9,0,0,0,2.69,1.13h1.5a9.16,9.16,0,0,0,2-.25v9.87c-.5.17-1.15.36-1.94.57s-1.6.39-2.44.56-1.66.29-2.5.37a20,20,0,0,1-2.12.13,13.78,13.78,0,0,1-7.25-1.75q-2.88-1.76-3.75-6.13a25.22,25.22,0,0,1-10.44,6,41.07,41.07,0,0,1-11.94,1.88A29.3,29.3,0,0,1,1171,121a21.91,21.91,0,0,1-7.06-3.5,16.73,16.73,0,0,1-4.88-5.87,18.11,18.11,0,0,1-1.81-8.32,19.18,19.18,0,0,1,2.19-9.75,16.11,16.11,0,0,1,5.75-5.87,25.69,25.69,0,0,1,8-3.06,89.73,89.73,0,0,1,8.93-1.44,70.87,70.87,0,0,1,7.38-1.06,34.94,34.94,0,0,0,6.19-1.07A9.54,9.54,0,0,0,1200,78.7a6.37,6.37,0,0,0,1.56-4.69,7.34,7.34,0,0,0-1.31-4.5,8.86,8.86,0,0,0-3.25-2.68,13.74,13.74,0,0,0-4.32-1.25,34.25,34.25,0,0,0-4.5-.32,17.93,17.93,0,0,0-9.87,2.5,9.76,9.76,0,0,0-4.38,7.75h-14.25a21.45,21.45,0,0,1,3-10.37,20.76,20.76,0,0,1,6.69-6.63,27.57,27.57,0,0,1,9.19-3.5,55.13,55.13,0,0,1,10.5-1,44.65,44.65,0,0,1,9.37,1,26.71,26.71,0,0,1,8.32,3.25,18,18,0,0,1,5.93,5.82,15.93,15.93,0,0,1,2.25,8.68Zm-14.25-18a17.32,17.32,0,0,1-8,2.57q-4.74.44-9.5,1.31a30,30,0,0,0-4.37,1.06,12.93,12.93,0,0,0-3.75,1.88,8.1,8.1,0,0,0-2.56,3.12,10.63,10.63,0,0,0-.94,4.69,6,6,0,0,0,1.37,4,9.94,9.94,0,0,0,3.32,2.56,15.07,15.07,0,0,0,4.25,1.31,26.33,26.33,0,0,0,4.18.38,23.07,23.07,0,0,0,5.13-.63,17,17,0,0,0,5.19-2.12,13.8,13.8,0,0,0,4.06-3.81,9.69,9.69,0,0,0,1.62-5.69Z" />
                    <path class="cls-1"
                      d="M1230.27,55.76h13.37v12.5h.25a14.47,14.47,0,0,1,2.44-5.12,23.55,23.55,0,0,1,4.38-4.56,22.05,22.05,0,0,1,5.68-3.32,17.13,17.13,0,0,1,6.38-1.25,31.6,31.6,0,0,1,3.44.13l1.93.25V68.14c-1-.17-2-.31-3.06-.44a26.73,26.73,0,0,0-3.06-.19,16.32,16.32,0,0,0-6.81,1.44,15.76,15.76,0,0,0-5.57,4.25,21,21,0,0,0-3.75,6.94,30.24,30.24,0,0,0-1.37,9.5v30.75h-14.25Z" />
                    <path class="cls-1"
                      d="M1267.14,55.76h15.63L1299.64,104h.25l16.38-48.25h14.87L1306,123.89c-1.17,2.91-2.31,5.71-3.44,8.37a30.11,30.11,0,0,1-4.12,7.07,17.89,17.89,0,0,1-6.07,4.87,20.62,20.62,0,0,1-9.25,1.81,64.81,64.81,0,0,1-9.87-.75v-12c1.16.17,2.29.36,3.37.57a18.63,18.63,0,0,0,3.38.31,11.51,11.51,0,0,0,4.12-.63,6.74,6.74,0,0,0,2.69-1.81,11.22,11.22,0,0,0,1.81-2.81,28.64,28.64,0,0,0,1.38-3.75l1.62-5Z" />
                    <path class="cls-1"
                      d="M1403.52,122.14a35.31,35.31,0,0,1-13.81-2.56,29.4,29.4,0,0,1-10.25-7.07,30.09,30.09,0,0,1-6.38-10.75,43.85,43.85,0,0,1,0-27.37,30.09,30.09,0,0,1,6.38-10.75,29.25,29.25,0,0,1,10.25-7.06,38.39,38.39,0,0,1,27.62,0,29.34,29.34,0,0,1,10.25,7.06A30.24,30.24,0,0,1,1434,74.39a44,44,0,0,1,0,27.37,30.24,30.24,0,0,1-6.38,10.75,29.5,29.5,0,0,1-10.25,7.07A35.35,35.35,0,0,1,1403.52,122.14Zm0-11.25a16.42,16.42,0,0,0,8.25-2,17.35,17.35,0,0,0,5.75-5.25,23,23,0,0,0,3.31-7.31,32.91,32.91,0,0,0,0-16.57,22.18,22.18,0,0,0-3.31-7.31,17.83,17.83,0,0,0-5.75-5.19,18,18,0,0,0-16.5,0,17.73,17.73,0,0,0-5.75,5.19,22,22,0,0,0-3.31,7.31,32.61,32.61,0,0,0,0,16.57,22.83,22.83,0,0,0,3.31,7.31,17.25,17.25,0,0,0,5.75,5.25A16.37,16.37,0,0,0,1403.52,110.89Z" />
                    <path class="cls-1"
                      d="M1441.64,55.76h10.63V50.39a27.59,27.59,0,0,1,1.5-9.94,14,14,0,0,1,4-5.87,13,13,0,0,1,5.68-2.75,31.62,31.62,0,0,1,6.69-.69,41,41,0,0,1,10,.87V43.14a19.9,19.9,0,0,0-2.94-.56,30.26,30.26,0,0,0-3.68-.19,8.73,8.73,0,0,0-4.94,1.37c-1.38.92-2.06,2.71-2.06,5.38v6.62h12.12V66.39h-12.12v54h-14.25v-54h-10.63Z" />
                    <path class="cls-1"
                      d="M1523.89,31.14h22L1570.51,101h.25l24-69.87h21.75v89.25h-14.87V51.51h-.25l-24.75,68.88h-12.88L1539,51.51h-.25v68.88h-14.87Z" />
                    <path class="cls-1"
                      d="M1644.39,91.76a24.75,24.75,0,0,0,1.06,7.25,17.8,17.8,0,0,0,3.19,6.13,15.45,15.45,0,0,0,5.37,4.19,17.77,17.77,0,0,0,7.75,1.56q6.26,0,10.07-2.69a15.89,15.89,0,0,0,5.68-8.06H1691a26.76,26.76,0,0,1-10.5,16.31,28.53,28.53,0,0,1-8.68,4.25,35,35,0,0,1-10.07,1.44,34.36,34.36,0,0,1-13.5-2.5,27.91,27.91,0,0,1-9.93-7,29.73,29.73,0,0,1-6.13-10.75,43.83,43.83,0,0,1-2.06-13.75,38.84,38.84,0,0,1,2.19-13.06,33.28,33.28,0,0,1,6.25-10.88A29.3,29.3,0,0,1,1661.39,54a29.07,29.07,0,0,1,13.69,3.19,30.14,30.14,0,0,1,10.06,8.44A34.3,34.3,0,0,1,1691,77.7a37,37,0,0,1,.94,14.06Zm33.25-9.37a23.13,23.13,0,0,0-1.44-6.5,17.23,17.23,0,0,0-3.25-5.44,16.07,16.07,0,0,0-5-3.75,14.72,14.72,0,0,0-6.56-1.44,17,17,0,0,0-6.81,1.32,15.36,15.36,0,0,0-5.25,3.62,17.84,17.84,0,0,0-3.5,5.44,18.76,18.76,0,0,0-1.44,6.75Z" />
                    <path class="cls-1"
                      d="M1763.64,120.39h-13.5v-8.75h-.25a16.91,16.91,0,0,1-8.38,8.06,28.26,28.26,0,0,1-11.62,2.44,30.85,30.85,0,0,1-13.31-2.69,26.5,26.5,0,0,1-9.44-7.31,31.27,31.27,0,0,1-5.63-10.94,47.43,47.43,0,0,1-1.87-13.56A43.46,43.46,0,0,1,1702,72.51a30.33,30.33,0,0,1,6.32-10.5,24.3,24.3,0,0,1,9-6.06A28.64,28.64,0,0,1,1727.64,54a34,34,0,0,1,6.12.57,26.68,26.68,0,0,1,6,1.81,23.33,23.33,0,0,1,5.32,3.19,17.84,17.84,0,0,1,4.06,4.56h.25v-33h14.25Zm-49.75-31.63a31.5,31.5,0,0,0,1.06,8.13,22.18,22.18,0,0,0,3.25,7.12,15.81,15.81,0,0,0,13.56,6.88,16,16,0,0,0,8.19-2,17,17,0,0,0,5.63-5.25,24.09,24.09,0,0,0,3.25-7.31,33.12,33.12,0,0,0,1.06-8.32q0-10.74-4.81-16.75a15.87,15.87,0,0,0-13.07-6,16.06,16.06,0,0,0-8.43,2.07A17.21,17.21,0,0,0,1718,72.7a22.21,22.21,0,0,0-3.12,7.5A38.78,38.78,0,0,0,1713.89,88.76Z" />
                    <path class="cls-1" d="M1779.51,31.14h14.25v13.5h-14.25Zm0,24.62h14.25v64.63h-14.25Z" />
                    <path class="cls-1"
                      d="M1852.89,77.39q-.89-6-4.82-9.06a15.62,15.62,0,0,0-9.93-3.07,20.65,20.65,0,0,0-5.88.94,14,14,0,0,0-5.75,3.5,19.49,19.49,0,0,0-4.37,7.13,33.82,33.82,0,0,0-1.75,11.93,35.16,35.16,0,0,0,.93,8,22.05,22.05,0,0,0,3,7.13,16.3,16.3,0,0,0,5.32,5.06,15.1,15.1,0,0,0,7.87,1.94,14.29,14.29,0,0,0,10.31-3.88q4.07-3.87,5.07-10.87h14.25q-2,12.63-9.57,19.31t-20.06,6.69a33.22,33.22,0,0,1-13.44-2.56,28.68,28.68,0,0,1-9.81-7A29.59,29.59,0,0,1,1808.2,102a41.12,41.12,0,0,1-2.06-13.25,45,45,0,0,1,2-13.62,31.05,31.05,0,0,1,6-11.06,28,28,0,0,1,9.93-7.38A33.59,33.59,0,0,1,1838,54a38.93,38.93,0,0,1,10.69,1.44,28.42,28.42,0,0,1,9,4.31,23.17,23.17,0,0,1,6.44,7.25,25.06,25.06,0,0,1,3,10.38Z" />
                    <path class="cls-1" d="M1879.14,31.14h14.25v13.5h-14.25Zm0,24.62h14.25v64.63h-14.25Z" />
                    <path class="cls-1"
                      d="M1908.89,55.76h13.5v9.5l.25.25a23.83,23.83,0,0,1,8.5-8.43A22.56,22.56,0,0,1,1942.76,54q10.62,0,16.75,5.5t6.13,16.5v44.38h-14.25V79.76q-.26-7.62-3.25-11.06t-9.38-3.44a15.41,15.41,0,0,0-6.5,1.32,14,14,0,0,0-4.87,3.62,17,17,0,0,0-3.13,5.44,19.38,19.38,0,0,0-1.12,6.62v38.13h-14.25Z" />
                    <path class="cls-1"
                      d="M1991.76,91.76a24.75,24.75,0,0,0,1.06,7.25,17.8,17.8,0,0,0,3.19,6.13,15.48,15.48,0,0,0,5.38,4.19,17.74,17.74,0,0,0,7.75,1.56q6.24,0,10.06-2.69a15.9,15.9,0,0,0,5.69-8.06h13.5a26.88,26.88,0,0,1-10.5,16.31,28.59,28.59,0,0,1-8.69,4.25,34.91,34.91,0,0,1-10.06,1.44,34.29,34.29,0,0,1-13.5-2.5,27.94,27.94,0,0,1-9.94-7,29.73,29.73,0,0,1-6.13-10.75,43.83,43.83,0,0,1-2.06-13.75,38.84,38.84,0,0,1,2.19-13.06A33.46,33.46,0,0,1,1986,64.2,29.3,29.3,0,0,1,2008.76,54a29,29,0,0,1,13.69,3.19,30.14,30.14,0,0,1,10.06,8.44,34.13,34.13,0,0,1,5.81,12.06,37,37,0,0,1,.94,14.06ZM2025,82.39a23.13,23.13,0,0,0-1.44-6.5,17.23,17.23,0,0,0-3.25-5.44,16.07,16.07,0,0,0-5-3.75,14.69,14.69,0,0,0-6.56-1.44,17,17,0,0,0-6.81,1.32,15.55,15.55,0,0,0-5.25,3.62,17.84,17.84,0,0,0-3.5,5.44,18.76,18.76,0,0,0-1.44,6.75Z" />
                    <path class="cls-1"
                      d="M438.78,164.56l19.12,44.33h.15L467,164.56h6.9l-11.33,53.55H454.9l-19-44h-.15l-9.08,44h-6.9l11.33-53.55Z" />
                    <path class="cls-1"
                      d="M479.39,185.45a14.1,14.1,0,0,1,3.79-3.94,15.83,15.83,0,0,1,5.1-2.32,23.15,23.15,0,0,1,5.92-.75,31.06,31.06,0,0,1,5.4.45,13.69,13.69,0,0,1,4.5,1.57,8.55,8.55,0,0,1,3.11,3,9.13,9.13,0,0,1,1.17,4.84,16.68,16.68,0,0,1-.42,3.56c-.27,1.27-.53,2.44-.78,3.49L504.7,206c-.15.8-.36,1.7-.64,2.7a11,11,0,0,0-.41,2.85,2.64,2.64,0,0,0,.53,1.88,1.82,1.82,0,0,0,1.35.52,3.12,3.12,0,0,0,1-.19l1-.33-1,4.72a12.34,12.34,0,0,1-1.92.56,8.91,8.91,0,0,1-2,.27,5.23,5.23,0,0,1-4-1.43,4.69,4.69,0,0,1-1.05-4l-.15-.15a13.35,13.35,0,0,1-5,4.12,18.69,18.69,0,0,1-8,1.43,17.94,17.94,0,0,1-4.62-.57,9.5,9.5,0,0,1-3.71-1.87,9.3,9.3,0,0,1-2.51-3.38,12.1,12.1,0,0,1-.94-5.06,10.71,10.71,0,0,1,1.84-6.67,11.57,11.57,0,0,1,4.69-3.64,23.14,23.14,0,0,1,6.3-1.69q3.45-.45,6.67-.75c1.7-.15,3.16-.31,4.39-.49a9.91,9.91,0,0,0,3-.86,3.81,3.81,0,0,0,1.76-1.72,7.06,7.06,0,0,0,.56-3.08,4.07,4.07,0,0,0-.75-2.55,5.39,5.39,0,0,0-1.87-1.54,8.85,8.85,0,0,0-2.52-.78,16.59,16.59,0,0,0-2.66-.23,17,17,0,0,0-3.56.38,10.28,10.28,0,0,0-3.19,1.23,8.35,8.35,0,0,0-2.4,2.18,7.13,7.13,0,0,0-1.27,3.19H477.4A13.45,13.45,0,0,1,479.39,185.45Zm1.8,26.59a8.86,8.86,0,0,0,4.84,1.35q7.58,0,10.87-5.1a12.73,12.73,0,0,0,2.14-4.73c.37-1.7.79-3.45,1.24-5.25h-.15a8.74,8.74,0,0,1-3.42,1.39c-1.37.27-2.83.49-4.38.64s-3.12.33-4.69.56A18.11,18.11,0,0,0,483.4,202a7.84,7.84,0,0,0-3.07,2.13,6,6,0,0,0-1.28,3.87A4.47,4.47,0,0,0,481.19,212Z" />
                    <path class="cls-1"
                      d="M536.65,179.34l-1.2,5.62h-7.72l-4.8,22.8c0,.45-.1.88-.15,1.28a10.18,10.18,0,0,0-.08,1.27,2.08,2.08,0,0,0,1.16,2.06,6,6,0,0,0,2.67.57,9.48,9.48,0,0,0,1.87-.19,17.19,17.19,0,0,0,1.8-.49l-1.12,5.85c-.75.1-1.5.19-2.25.26a21.2,21.2,0,0,1-2.25.12,20,20,0,0,1-3.38-.27,7.61,7.61,0,0,1-2.74-1,5.52,5.52,0,0,1-1.87-1.91,5.93,5.93,0,0,1-.71-3.08,9.92,9.92,0,0,1,.11-1.57c.07-.5.16-1.05.26-1.65l5.1-24.08h-6.52l1.2-5.62h6.52l2.4-11.48h6.38l-2.4,11.48Z" />
                    <path class="cls-1" d="M550.08,179.34,542,218.11h-6.3l8-38.77Zm-5-7,1.65-7.8h6.45l-1.65,7.8Z" />
                    <path class="cls-1"
                      d="M555.36,193.66a23.64,23.64,0,0,1,4.28-7.8,21.21,21.21,0,0,1,6.82-5.4,20,20,0,0,1,9.11-2q7.88,0,12,4.08t4.13,12a29.67,29.67,0,0,1-1.43,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.69,19.69,0,0,1-9.07,2,18.72,18.72,0,0,1-6.86-1.2A14.26,14.26,0,0,1,555,209.3a18.17,18.17,0,0,1-1.12-6.49A29.11,29.11,0,0,1,555.36,193.66Zm7.62,16.8q2.68,2.92,7.94,2.93a10.78,10.78,0,0,0,6.19-1.8,16.48,16.48,0,0,0,4.5-4.54,21.36,21.36,0,0,0,2.78-6,22,22,0,0,0,.93-6.08,15.3,15.3,0,0,0-.59-4.27,9.33,9.33,0,0,0-1.88-3.49,9.12,9.12,0,0,0-3.19-2.33,11,11,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8A16.35,16.35,0,0,0,564,190.4a20.61,20.61,0,0,0-2.81,6,23.25,23.25,0,0,0-.94,6.3A10.89,10.89,0,0,0,563,210.46Z" />
                    <path class="cls-1"
                      d="M609.62,179.34l-1.2,5.85h.15a15.14,15.14,0,0,1,6.08-5.07,18.35,18.35,0,0,1,7.72-1.68c3.65,0,6.37.8,8.14,2.4s2.66,4.12,2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.47,2.78-.82,4.28l-4.73,22.12H621l4.95-22.65c.05-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.27-1.65a10.28,10.28,0,0,0,.11-1.31,4.59,4.59,0,0,0-1.95-4.09,8.44,8.44,0,0,0-4.8-1.31,11.67,11.67,0,0,0-5.21,1.28,14.73,14.73,0,0,0-4.39,3.22,10.53,10.53,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l8.1-38.77Z" />
                    <path class="cls-1"
                      d="M643.34,185.45a14.06,14.06,0,0,1,3.78-3.94,15.83,15.83,0,0,1,5.1-2.32,23.22,23.22,0,0,1,5.93-.75,31.06,31.06,0,0,1,5.4.45,13.69,13.69,0,0,1,4.5,1.57,8.55,8.55,0,0,1,3.11,3,9.13,9.13,0,0,1,1.16,4.84,16.64,16.64,0,0,1-.41,3.56c-.27,1.27-.54,2.44-.79,3.49L668.65,206c-.15.8-.36,1.7-.64,2.7a11,11,0,0,0-.41,2.85,2.64,2.64,0,0,0,.52,1.88,1.82,1.82,0,0,0,1.35.52,3.18,3.18,0,0,0,1-.19l1-.33-1,4.72a12.18,12.18,0,0,1-1.91.56,9,9,0,0,1-2,.27,5.21,5.21,0,0,1-4-1.43,4.69,4.69,0,0,1-1-4l-.15-.15a13.38,13.38,0,0,1-5,4.12,18.69,18.69,0,0,1-7.95,1.43,17.86,17.86,0,0,1-4.61-.57,9.5,9.5,0,0,1-3.71-1.87,9.3,9.3,0,0,1-2.51-3.38,12.1,12.1,0,0,1-.94-5.06,10.71,10.71,0,0,1,1.84-6.67,11.53,11.53,0,0,1,4.68-3.64,23.14,23.14,0,0,1,6.3-1.69q3.45-.45,6.68-.75c1.7-.15,3.16-.31,4.39-.49a9.84,9.84,0,0,0,3-.86,3.84,3.84,0,0,0,1.77-1.72,7.06,7.06,0,0,0,.56-3.08,4.07,4.07,0,0,0-.75-2.55,5.43,5.43,0,0,0-1.88-1.54,8.78,8.78,0,0,0-2.51-.78,16.59,16.59,0,0,0-2.66-.23,17,17,0,0,0-3.56.38,10.28,10.28,0,0,0-3.19,1.23,8.35,8.35,0,0,0-2.4,2.18,7.14,7.14,0,0,0-1.28,3.19h-6.37A13.45,13.45,0,0,1,643.34,185.45Zm1.8,26.59a8.83,8.83,0,0,0,4.83,1.35q7.57,0,10.88-5.1a12.73,12.73,0,0,0,2.14-4.73q.56-2.55,1.23-5.25h-.15a8.69,8.69,0,0,1-3.41,1.39c-1.37.27-2.84.49-4.39.64s-3.11.33-4.68.56a18.11,18.11,0,0,0-4.24,1.09,7.88,7.88,0,0,0-3.08,2.13A6,6,0,0,0,643,208,4.47,4.47,0,0,0,645.14,212Z" />
                    <path class="cls-1" d="M693.55,164.56,682.3,218.11H676l11.17-53.55Z" />
                    <path class="cls-1"
                      d="M755.39,214.17q-5.89,5.15-15.79,5.14-11,0-17-6.11t-6-17.29a37.86,37.86,0,0,1,2-12.41,32.13,32.13,0,0,1,5.82-10.39,27.51,27.51,0,0,1,21.56-9.82,26.66,26.66,0,0,1,8.06,1.16,18.43,18.43,0,0,1,6.45,3.45,15.87,15.87,0,0,1,4.31,5.77,19.64,19.64,0,0,1,1.58,8.14h-7.13q0-6.3-3.71-9.41a14.34,14.34,0,0,0-9.56-3.11,19.47,19.47,0,0,0-9.79,2.36,22.07,22.07,0,0,0-6.94,6.11,26.89,26.89,0,0,0-4.16,8.51,34.16,34.16,0,0,0-1.39,9.64,24.58,24.58,0,0,0,1,7.13,15.14,15.14,0,0,0,2.92,5.51,13.23,13.23,0,0,0,4.92,3.56,17.62,17.62,0,0,0,7,1.28q6.6,0,10.72-3.49a19,19,0,0,0,5.85-9.86h7.13Q761.28,209,755.39,214.17Z" />
                    <path class="cls-1"
                      d="M775.07,204a9.33,9.33,0,0,0,.83,4,8.21,8.21,0,0,0,2.25,2.93,10.91,10.91,0,0,0,3.22,1.8,11.28,11.28,0,0,0,3.75.64,12.12,12.12,0,0,0,7-1.92A11.25,11.25,0,0,0,796.3,206h6.37a16.72,16.72,0,0,1-2.4,5.66,15.16,15.16,0,0,1-4,4,17.5,17.5,0,0,1-5.18,2.44,21.47,21.47,0,0,1-6,.83,19.1,19.1,0,0,1-8-1.47,13.82,13.82,0,0,1-5.06-3.75,13.45,13.45,0,0,1-2.62-5,20,20,0,0,1-.75-5.29,30.46,30.46,0,0,1,1.61-10.16,25.1,25.1,0,0,1,4.35-7.91,19.42,19.42,0,0,1,6.37-5.1,17,17,0,0,1,7.62-1.8q8.55,0,12.48,4.5t3.94,12.67a17.34,17.34,0,0,1-.22,2.85c-.15.9-.28,1.63-.38,2.18H775.3A24.88,24.88,0,0,0,775.07,204Zm23.36-13a9.17,9.17,0,0,0-1.5-3.53,7.9,7.9,0,0,0-2.88-2.47,9.45,9.45,0,0,0-4.43-.94,13.78,13.78,0,0,0-5,.86,12.5,12.5,0,0,0-3.86,2.37,14,14,0,0,0-2.77,3.48,20.71,20.71,0,0,0-1.8,4.24h22.5A14.2,14.2,0,0,0,798.43,191Z" />
                    <path class="cls-1"
                      d="M822.17,179.34l-1.2,5.85h.15a15.14,15.14,0,0,1,6.08-5.07,18.31,18.31,0,0,1,7.72-1.68q5.48,0,8.14,2.4t2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.48,2.78-.82,4.28l-4.73,22.12H833.5l5-22.65c0-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.26-1.65a8.91,8.91,0,0,0,.12-1.31,4.59,4.59,0,0,0-2-4.09,8.44,8.44,0,0,0-4.8-1.31,11.75,11.75,0,0,0-5.22,1.28,14.81,14.81,0,0,0-4.38,3.22,10.41,10.41,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l8.1-38.77Z" />
                    <path class="cls-1"
                      d="M874.22,179.34,873,185H865.3l-4.8,22.8c0,.45-.11.88-.15,1.28a10.18,10.18,0,0,0-.08,1.27,2.08,2.08,0,0,0,1.16,2.06,6,6,0,0,0,2.67.57,9.48,9.48,0,0,0,1.87-.19,17.19,17.19,0,0,0,1.8-.49l-1.12,5.85c-.75.1-1.5.19-2.25.26a21.2,21.2,0,0,1-2.25.12,20,20,0,0,1-3.38-.27,7.61,7.61,0,0,1-2.74-1,5.52,5.52,0,0,1-1.87-1.91,5.93,5.93,0,0,1-.71-3.08,9.92,9.92,0,0,1,.11-1.57c.07-.5.16-1.05.26-1.65l5.1-24.08H852.4l1.2-5.62h6.52l2.4-11.48h6.38l-2.4,11.48Z" />
                    <path class="cls-1"
                      d="M880.67,204a9.19,9.19,0,0,0,.83,4,8.21,8.21,0,0,0,2.25,2.93,10.79,10.79,0,0,0,3.22,1.8,11.28,11.28,0,0,0,3.75.64,12.12,12.12,0,0,0,7-1.92,11.17,11.17,0,0,0,4.12-5.51h6.38a16.72,16.72,0,0,1-2.4,5.66,15.2,15.2,0,0,1-4,4,17.33,17.33,0,0,1-5.17,2.44,21.47,21.47,0,0,1-6,.83,19.1,19.1,0,0,1-8-1.47,13.82,13.82,0,0,1-5.06-3.75,13.3,13.3,0,0,1-2.62-5,20,20,0,0,1-.75-5.29,30.46,30.46,0,0,1,1.61-10.16,25.1,25.1,0,0,1,4.35-7.91,19.42,19.42,0,0,1,6.37-5.1,17,17,0,0,1,7.62-1.8q8.55,0,12.48,4.5t3.94,12.67a17.34,17.34,0,0,1-.22,2.85c-.15.9-.28,1.63-.38,2.18H880.89A26.62,26.62,0,0,0,880.67,204ZM904,191a9.17,9.17,0,0,0-1.5-3.53,7.85,7.85,0,0,0-2.89-2.47,9.38,9.38,0,0,0-4.42-.94,13.78,13.78,0,0,0-5,.86,12.5,12.5,0,0,0-3.86,2.37,14,14,0,0,0-2.77,3.48,20.71,20.71,0,0,0-1.8,4.24h22.5A14.58,14.58,0,0,0,904,191Z" />
                    <path class="cls-1"
                      d="M927.54,179.34l-1.87,8.32h.15a21.18,21.18,0,0,1,5.74-6.6,13.49,13.49,0,0,1,8.36-2.62,7.87,7.87,0,0,0,1.12-.08,3,3,0,0,1,1.13.08l-1.5,6.82a4.6,4.6,0,0,0-1-.07h-.9c-.8,0-1.45,0-1.94,0a9.68,9.68,0,0,0-1.88.34,12.38,12.38,0,0,0-4.69,2.33,16.56,16.56,0,0,0-3.56,4,15.72,15.72,0,0,0-2,4.39c-.5,1.67-.9,3.24-1.2,4.69l-3.67,17.17h-6.3l8-38.77Z" />
                    <path class="cls-1"
                      d="M962,185l1.12-5.62h6.6c.5-2,1-3.85,1.39-5.7a18.7,18.7,0,0,1,1.84-4.92,9.43,9.43,0,0,1,3.34-3.45,11.43,11.43,0,0,1,6-1.31c.9,0,1.8,0,2.7.11a13.47,13.47,0,0,1,2.62.49l-1,5.4c-.55-.1-1.07-.19-1.57-.26a9,9,0,0,0-1.43-.11,6.35,6.35,0,0,0-3.6.86,5.82,5.82,0,0,0-2,2.25,11.28,11.28,0,0,0-1,3.11c-.23,1.15-.52,2.33-.87,3.53h7.43l-1,5.62h-7.5l-7.13,33.15h-6.37l7.2-33.15Z" />
                    <path class="cls-1"
                      d="M984.58,193.66a23.64,23.64,0,0,1,4.28-7.8,21.21,21.21,0,0,1,6.82-5.4,19.92,19.92,0,0,1,9.11-2q7.88,0,12,4.08t4.13,12a29.67,29.67,0,0,1-1.43,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.69,19.69,0,0,1-9.07,2,18.72,18.72,0,0,1-6.86-1.2,14.26,14.26,0,0,1-8.37-8.44,18.17,18.17,0,0,1-1.12-6.49A29.11,29.11,0,0,1,984.58,193.66Zm7.61,16.8q2.7,2.92,7.95,2.93a10.78,10.78,0,0,0,6.19-1.8,16.76,16.76,0,0,0,4.5-4.54,21.36,21.36,0,0,0,2.78-6,22,22,0,0,0,.93-6.08,14.94,14.94,0,0,0-.6-4.27,8.9,8.9,0,0,0-5.06-5.82,11,11,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.61,20.61,0,0,0-2.81,6,23.25,23.25,0,0,0-.94,6.3A10.93,10.93,0,0,0,992.19,210.46Z" />
                    <path class="cls-1"
                      d="M1038.62,179.34l-1.88,8.32h.15a21.18,21.18,0,0,1,5.74-6.6,13.49,13.49,0,0,1,8.36-2.62,8,8,0,0,0,1.13-.08,2.9,2.9,0,0,1,1.12.08l-1.5,6.82a4.49,4.49,0,0,0-1-.07h-.9q-1.2,0-1.95,0a9.82,9.82,0,0,0-1.88.34,12.38,12.38,0,0,0-4.69,2.33,16.56,16.56,0,0,0-3.56,4,15.71,15.71,0,0,0-2,4.39c-.5,1.67-.9,3.24-1.2,4.69l-3.68,17.17h-6.3l8-38.77Z" />
                    <path class="cls-1"
                      d="M1103.94,164.56q7.88,0,11.4,3.38t3.53,9.45a14.08,14.08,0,0,1-2.74,8.28,12.49,12.49,0,0,1-3.19,3,10.55,10.55,0,0,1-4.27,1.62v.15a10.83,10.83,0,0,1,5.85,3.93,11.59,11.59,0,0,1,2.17,7.17,15.94,15.94,0,0,1-1.46,6.9,15.23,15.23,0,0,1-4,5.21,19.06,19.06,0,0,1-6,3.3,23.21,23.21,0,0,1-7.42,1.16h-26.48l11.18-53.55Zm-7.35,47.55a31.91,31.91,0,0,0,3.53-.26,12.71,12.71,0,0,0,4.27-1.35,10.58,10.58,0,0,0,3.64-3.19,9.62,9.62,0,0,0,1.54-5.77,8.29,8.29,0,0,0-.9-4.13,6.12,6.12,0,0,0-2.44-2.4,10.84,10.84,0,0,0-3.53-1.12,27.79,27.79,0,0,0-4.16-.3h-15.3l-3.9,18.52Zm3.75-24.52q11.4,0,11.4-10.2a6.17,6.17,0,0,0-1-3.75,6.31,6.31,0,0,0-2.59-2,11.47,11.47,0,0,0-3.41-.86,33.17,33.17,0,0,0-3.49-.19H1088l-3.6,17Z" />
                    <path class="cls-1" d="M1136.19,179.34l-8.1,38.77h-6.3l8-38.77Zm-5-7,1.65-7.8h6.45l-1.65,7.8Z" />
                    <path class="cls-1"
                      d="M1141.48,193.66a23.62,23.62,0,0,1,4.27-7.8,21.24,21.24,0,0,1,6.83-5.4,19.92,19.92,0,0,1,9.11-2q7.88,0,12,4.08t4.12,12a29.66,29.66,0,0,1-1.42,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.74,19.74,0,0,1-9.08,2,18.76,18.76,0,0,1-6.86-1.2,14.21,14.21,0,0,1-8.36-8.44,18.17,18.17,0,0,1-1.12-6.49A28.83,28.83,0,0,1,1141.48,193.66Zm7.61,16.8q2.7,2.92,8,2.93a10.8,10.8,0,0,0,6.19-1.8,16.76,16.76,0,0,0,4.5-4.54,21.33,21.33,0,0,0,2.77-6,21.66,21.66,0,0,0,.94-6.08,14.94,14.94,0,0,0-.6-4.27,9,9,0,0,0-5.06-5.82,11.08,11.08,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.36,20.36,0,0,0-2.81,6,22.87,22.87,0,0,0-.94,6.3A10.93,10.93,0,0,0,1149.09,210.46Z" />
                    <path class="cls-1"
                      d="M1206.09,179.34l-1.2,5.62h-7.73l-4.8,22.8c0,.45-.1.88-.15,1.28a10.24,10.24,0,0,0-.07,1.27,2.07,2.07,0,0,0,1.16,2.06,6,6,0,0,0,2.66.57,9.59,9.59,0,0,0,1.88-.19,17.19,17.19,0,0,0,1.8-.49l-1.13,5.85c-.75.1-1.5.19-2.25.26a21.2,21.2,0,0,1-2.25.12,19.92,19.92,0,0,1-3.37-.27,7.61,7.61,0,0,1-2.74-1,5.52,5.52,0,0,1-1.87-1.91,5.93,5.93,0,0,1-.72-3.08,9.9,9.9,0,0,1,.12-1.57c.07-.5.16-1.05.26-1.65l5.1-24.08h-6.53l1.2-5.62H1192l2.4-11.48h6.37l-2.4,11.48Z" />
                    <path class="cls-1"
                      d="M1212.54,204a9.33,9.33,0,0,0,.82,4,8.21,8.21,0,0,0,2.25,2.93,11,11,0,0,0,3.23,1.8,11.28,11.28,0,0,0,3.75.64,12.12,12.12,0,0,0,7.05-1.92,11.23,11.23,0,0,0,4.12-5.51h6.38a16.72,16.72,0,0,1-2.4,5.66,15.2,15.2,0,0,1-4,4,17.44,17.44,0,0,1-5.17,2.44,21.47,21.47,0,0,1-6,.83,19.1,19.1,0,0,1-8-1.47,13.73,13.73,0,0,1-5.06-3.75,13.47,13.47,0,0,1-2.63-5,20,20,0,0,1-.75-5.29,30.71,30.71,0,0,1,1.61-10.16,25.31,25.31,0,0,1,4.36-7.91,19.32,19.32,0,0,1,6.37-5.1,16.93,16.93,0,0,1,7.61-1.8q8.55,0,12.49,4.5t3.94,12.67a17.32,17.32,0,0,1-.23,2.85c-.15.9-.27,1.63-.37,2.18h-29.18A24.88,24.88,0,0,0,1212.54,204Zm23.36-13a9.48,9.48,0,0,0-1.5-3.53,8,8,0,0,0-2.89-2.47,9.41,9.41,0,0,0-4.42-.94,13.74,13.74,0,0,0-5,.86,12.38,12.38,0,0,0-3.86,2.37,14.06,14.06,0,0,0-2.78,3.48,20.71,20.71,0,0,0-1.8,4.24h22.5A14.57,14.57,0,0,0,1235.9,191Z" />
                    <path class="cls-1"
                      d="M1274.71,186.05a8.54,8.54,0,0,0-6-2,12.6,12.6,0,0,0-6.49,1.65,15.46,15.46,0,0,0-4.72,4.28,19.2,19.2,0,0,0-2.89,5.88,22.39,22.39,0,0,0-1,6.42,18.44,18.44,0,0,0,.48,4.27,9.62,9.62,0,0,0,1.62,3.53,8,8,0,0,0,3,2.4,10.26,10.26,0,0,0,4.54.9,11.49,11.49,0,0,0,7-2.18,12.45,12.45,0,0,0,4.27-5.77h6.38a17.68,17.68,0,0,1-6.3,10.05,18.39,18.39,0,0,1-11.4,3.45q-8,0-12-4.35t-4-12.3a28.61,28.61,0,0,1,1.39-8.93,23.07,23.07,0,0,1,4.12-7.61,19.9,19.9,0,0,1,15.94-7.31q6.6,0,10.46,3.18t4.09,10h-6.37A7.19,7.19,0,0,0,1274.71,186.05Z" />
                    <path class="cls-1"
                      d="M1303.29,164.56,1298.71,185l.15.15a15.14,15.14,0,0,1,6.08-5.07,18.35,18.35,0,0,1,7.72-1.68q5.47,0,8.14,2.4t2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.47,2.78-.82,4.28l-4.73,22.12h-6.37l5-22.65c0-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.26-1.65a8.91,8.91,0,0,0,.12-1.31,4.59,4.59,0,0,0-1.95-4.09,8.44,8.44,0,0,0-4.8-1.31,11.75,11.75,0,0,0-5.22,1.28,14.81,14.81,0,0,0-4.38,3.22,10.53,10.53,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l11.25-53.55Z" />
                    <path class="cls-1"
                      d="M1341.61,179.34l-1.2,5.85h.15a15.14,15.14,0,0,1,6.08-5.07,18.35,18.35,0,0,1,7.72-1.68q5.48,0,8.14,2.4t2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.47,2.78-.82,4.28l-4.73,22.12h-6.37l5-22.65c0-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.26-1.65a8.91,8.91,0,0,0,.12-1.31,4.59,4.59,0,0,0-2-4.09,8.44,8.44,0,0,0-4.8-1.31,11.75,11.75,0,0,0-5.22,1.28,14.81,14.81,0,0,0-4.38,3.22,10.53,10.53,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l8.1-38.77Z" />
                    <path class="cls-1"
                      d="M1372.1,193.66a23.62,23.62,0,0,1,4.27-7.8,21.24,21.24,0,0,1,6.83-5.4,19.92,19.92,0,0,1,9.11-2q7.88,0,12,4.08t4.13,12a29.67,29.67,0,0,1-1.43,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.69,19.69,0,0,1-9.07,2,18.82,18.82,0,0,1-6.87-1.2,14.28,14.28,0,0,1-8.36-8.44,18.17,18.17,0,0,1-1.12-6.49A28.83,28.83,0,0,1,1372.1,193.66Zm7.61,16.8q2.7,2.92,8,2.93a10.8,10.8,0,0,0,6.19-1.8,16.76,16.76,0,0,0,4.5-4.54,21.33,21.33,0,0,0,2.77-6,21.66,21.66,0,0,0,.94-6.08,14.94,14.94,0,0,0-.6-4.27,8.9,8.9,0,0,0-5.06-5.82,11.08,11.08,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.36,20.36,0,0,0-2.81,6,22.87,22.87,0,0,0-.94,6.3A10.93,10.93,0,0,0,1379.71,210.46Z" />
                    <path class="cls-1" d="M1429.66,164.56l-11.25,53.55h-6.3l11.18-53.55Z" />
                    <path class="cls-1"
                      d="M1431.8,193.66a23.62,23.62,0,0,1,4.27-7.8,21.24,21.24,0,0,1,6.83-5.4,19.92,19.92,0,0,1,9.11-2q7.88,0,12,4.08t4.12,12a29.66,29.66,0,0,1-1.42,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.74,19.74,0,0,1-9.08,2,18.76,18.76,0,0,1-6.86-1.2,14.21,14.21,0,0,1-8.36-8.44,18.17,18.17,0,0,1-1.13-6.49A28.83,28.83,0,0,1,1431.8,193.66Zm7.61,16.8q2.7,2.92,7.95,2.93a10.8,10.8,0,0,0,6.19-1.8,16.76,16.76,0,0,0,4.5-4.54,21.33,21.33,0,0,0,2.77-6,21.66,21.66,0,0,0,.94-6.08,14.94,14.94,0,0,0-.6-4.27,9,9,0,0,0-5.06-5.82,11.08,11.08,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.36,20.36,0,0,0-2.81,6,22.87,22.87,0,0,0-.94,6.3A10.93,10.93,0,0,0,1439.41,210.46Z" />
                    <path class="cls-1"
                      d="M1505.11,218.22a42.28,42.28,0,0,1-1.58,4.77,16.38,16.38,0,0,1-6.9,8.32,21.65,21.65,0,0,1-10.72,2.48,23.88,23.88,0,0,1-5.74-.68,14.84,14.84,0,0,1-4.84-2.1,11.05,11.05,0,0,1-3.41-3.71,11.55,11.55,0,0,1-1.39-5.51h6.3a6.24,6.24,0,0,0,1,3.18,6.06,6.06,0,0,0,2.17,1.95,9.21,9.21,0,0,0,3,1,24,24,0,0,0,3.52.26,12.06,12.06,0,0,0,6-1.35,11.56,11.56,0,0,0,3.86-3.52,18.41,18.41,0,0,0,2.37-5c.57-1.88,1.11-3.76,1.61-5.66l-.15-.15a11.91,11.91,0,0,1-5.25,4.5,17.17,17.17,0,0,1-6.83,1.35,16,16,0,0,1-6.34-1.17,11.82,11.82,0,0,1-4.53-3.3,14.61,14.61,0,0,1-2.74-5.06,20.9,20.9,0,0,1-.94-6.45,27.41,27.41,0,0,1,1.39-8.55,25.65,25.65,0,0,1,4-7.69,20.83,20.83,0,0,1,6.33-5.55,16.87,16.87,0,0,1,8.48-2.13,15,15,0,0,1,4.16.56,15.29,15.29,0,0,1,3.68,1.57,10.67,10.67,0,0,1,2.85,2.48,8.52,8.52,0,0,1,1.61,3.26v.15h.15l1.2-7.12h6l-7,33.15Q1505.86,215.49,1505.11,218.22Zm-24.45-11.88a9.87,9.87,0,0,0,1.76,3.3,8.36,8.36,0,0,0,3,2.28,9.55,9.55,0,0,0,4.2.87,11,11,0,0,0,6.27-1.8,15.09,15.09,0,0,0,4.38-4.58,22.14,22.14,0,0,0,2.59-6,24.36,24.36,0,0,0,.86-6.18,10.75,10.75,0,0,0-2.43-7.35q-2.45-2.78-7.47-2.78a9.72,9.72,0,0,0-5.92,1.88,16.68,16.68,0,0,0-4.28,4.61,22.49,22.49,0,0,0-2.62,5.92,21.83,21.83,0,0,0-.9,5.89A13,13,0,0,0,1480.66,206.34Z" />
                    <path class="cls-1"
                      d="M1525,228.2a16.49,16.49,0,0,1-2.62,2.92,10.93,10.93,0,0,1-3.23,1.95,11.26,11.26,0,0,1-4.2.72,10.54,10.54,0,0,1-2.32-.27,8.76,8.76,0,0,1-2.1-.71l1.12-5.17a7.5,7.5,0,0,0,1.8.75,7.15,7.15,0,0,0,1.8.3,5.2,5.2,0,0,0,3.53-1.17,12.37,12.37,0,0,0,2.47-3l3.9-6.38-6.82-38.77h6.82l4.5,30.82h.15l16.28-30.82h7l-25.65,45.3C1526.58,225.89,1525.78,227.07,1525,228.2Z" />
                    <path class="cls-1" d="M1591,164.56l-11.25,53.55h-7.12l11.25-53.55Z" />
                    <path class="cls-1"
                      d="M1605.45,179.34l-1.2,5.85h.15a15.14,15.14,0,0,1,6.08-5.07,18.35,18.35,0,0,1,7.72-1.68c3.65,0,6.37.8,8.14,2.4s2.66,4.12,2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.47,2.78-.82,4.28l-4.73,22.12h-6.37l5-22.65c0-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.27-1.65a10.28,10.28,0,0,0,.11-1.31,4.59,4.59,0,0,0-2-4.09,8.44,8.44,0,0,0-4.8-1.31,11.67,11.67,0,0,0-5.21,1.28,14.73,14.73,0,0,0-4.39,3.22,10.53,10.53,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l8.1-38.77Z" />
                    <path class="cls-1"
                      d="M1635.53,185l1.12-5.62h6.6c.5-2,1-3.85,1.39-5.7a18.7,18.7,0,0,1,1.84-4.92,9.43,9.43,0,0,1,3.34-3.45,11.43,11.43,0,0,1,6-1.31c.9,0,1.8,0,2.7.11a13.47,13.47,0,0,1,2.62.49l-1,5.4c-.55-.1-1.07-.19-1.57-.26a9,9,0,0,0-1.43-.11,6.35,6.35,0,0,0-3.6.86,5.82,5.82,0,0,0-2,2.25,11.28,11.28,0,0,0-1,3.11c-.23,1.15-.52,2.33-.87,3.53H1657l-1,5.62h-7.5l-7.13,33.15h-6.37l7.2-33.15Z" />
                    <path class="cls-1"
                      d="M1658.14,193.66a23.64,23.64,0,0,1,4.28-7.8,21.21,21.21,0,0,1,6.82-5.4,20,20,0,0,1,9.11-2q7.88,0,12,4.08t4.13,12a29.67,29.67,0,0,1-1.43,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.69,19.69,0,0,1-9.07,2,18.72,18.72,0,0,1-6.86-1.2,14.26,14.26,0,0,1-8.37-8.44,18.17,18.17,0,0,1-1.12-6.49A29.11,29.11,0,0,1,1658.14,193.66Zm7.61,16.8q2.7,2.92,8,2.93a10.78,10.78,0,0,0,6.19-1.8,16.48,16.48,0,0,0,4.5-4.54,21.36,21.36,0,0,0,2.78-6,22,22,0,0,0,.93-6.08,14.94,14.94,0,0,0-.6-4.27,8.9,8.9,0,0,0-5.06-5.82,11,11,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.61,20.61,0,0,0-2.81,6,23.25,23.25,0,0,0-.94,6.3A10.93,10.93,0,0,0,1665.75,210.46Z" />
                    <path class="cls-1"
                      d="M1712.18,179.34l-1.88,8.32h.15a21.18,21.18,0,0,1,5.74-6.6,13.51,13.51,0,0,1,8.36-2.62,8,8,0,0,0,1.13-.08,2.9,2.9,0,0,1,1.12.08l-1.5,6.82a4.49,4.49,0,0,0-1-.07h-.9q-1.2,0-2,0a9.82,9.82,0,0,0-1.88.34,12.27,12.27,0,0,0-4.68,2.33,16.39,16.39,0,0,0-3.57,4,15.71,15.71,0,0,0-2,4.39c-.5,1.67-.9,3.24-1.2,4.69l-3.68,17.17h-6.3l8-38.77Z" />
                    <path class="cls-1"
                      d="M1737.23,179.34l-1.43,5.77.15.15a18.56,18.56,0,0,1,6-5,16,16,0,0,1,7.54-1.83,12,12,0,0,1,6.3,1.57,7.83,7.83,0,0,1,3.45,5.4,16.69,16.69,0,0,1,5.82-5.06,15.48,15.48,0,0,1,7.46-1.91,16.53,16.53,0,0,1,4,.48,11.55,11.55,0,0,1,3.49,1.5,7.46,7.46,0,0,1,2.44,2.67,8.36,8.36,0,0,1,.9,4,23.25,23.25,0,0,1-.38,3.9c-.25,1.45-.5,2.72-.75,3.82l-4.87,23.25h-6.38l5.4-24.6a21.64,21.64,0,0,0,.41-2.14,13.51,13.51,0,0,0,.19-2.06,4.8,4.8,0,0,0-1.69-3.75,6.11,6.11,0,0,0-4.23-1.5,8.83,8.83,0,0,0-2.74.45,15,15,0,0,0-2.66,1.16,15,15,0,0,0-4.35,3.72,11,11,0,0,0-2.33,4,43.53,43.53,0,0,0-1.27,4.73l-4.28,20H1747l4.65-22.12c.35-1.5.64-2.9.86-4.2a20.19,20.19,0,0,0,.34-2.63,5,5,0,0,0-1.39-3.75,5.53,5.53,0,0,0-4-1.35,10.34,10.34,0,0,0-5.22,1.5,17.3,17.3,0,0,0-4.31,3.45,10.93,10.93,0,0,0-2.77,3.94,33.21,33.21,0,0,0-1.35,4.84l-4.35,20.32h-6.3l8.17-38.77Z" />
                    <path class="cls-1"
                      d="M1793.29,185.45a14.1,14.1,0,0,1,3.79-3.94,15.83,15.83,0,0,1,5.1-2.32,23.15,23.15,0,0,1,5.92-.75,31.06,31.06,0,0,1,5.4.45,13.69,13.69,0,0,1,4.5,1.57,8.55,8.55,0,0,1,3.11,3,9.13,9.13,0,0,1,1.17,4.84,16.68,16.68,0,0,1-.42,3.56c-.27,1.27-.53,2.44-.78,3.49L1818.6,206c-.15.8-.36,1.7-.64,2.7a11,11,0,0,0-.41,2.85,2.64,2.64,0,0,0,.53,1.88,1.82,1.82,0,0,0,1.35.52,3.12,3.12,0,0,0,1-.19l1-.33-1,4.72a12.34,12.34,0,0,1-1.92.56,8.91,8.91,0,0,1-2,.27,5.23,5.23,0,0,1-4-1.43,4.69,4.69,0,0,1-1-4l-.15-.15a13.35,13.35,0,0,1-5,4.12,18.69,18.69,0,0,1-8,1.43,17.94,17.94,0,0,1-4.62-.57,9.5,9.5,0,0,1-3.71-1.87,9.3,9.3,0,0,1-2.51-3.38,12.1,12.1,0,0,1-.94-5.06,10.71,10.71,0,0,1,1.84-6.67,11.57,11.57,0,0,1,4.69-3.64,23.14,23.14,0,0,1,6.3-1.69q3.45-.45,6.67-.75c1.7-.15,3.16-.31,4.39-.49a9.91,9.91,0,0,0,3-.86,3.81,3.81,0,0,0,1.76-1.72,7.06,7.06,0,0,0,.56-3.08,4.07,4.07,0,0,0-.75-2.55,5.39,5.39,0,0,0-1.87-1.54,8.85,8.85,0,0,0-2.52-.78,16.59,16.59,0,0,0-2.66-.23,17,17,0,0,0-3.56.38,10.28,10.28,0,0,0-3.19,1.23,8.35,8.35,0,0,0-2.4,2.18,7.13,7.13,0,0,0-1.27,3.19h-6.38A13.45,13.45,0,0,1,1793.29,185.45Zm1.8,26.59a8.86,8.86,0,0,0,4.84,1.35q7.58,0,10.87-5.1a12.73,12.73,0,0,0,2.14-4.73c.37-1.7.79-3.45,1.24-5.25H1814a8.74,8.74,0,0,1-3.42,1.39c-1.37.27-2.83.49-4.38.64s-3.12.33-4.69.56a18.11,18.11,0,0,0-4.24,1.09,7.84,7.84,0,0,0-3.07,2.13A6,6,0,0,0,1793,208,4.47,4.47,0,0,0,1795.09,212Z" />
                    <path class="cls-1"
                      d="M1850.55,179.34l-1.2,5.62h-7.72l-4.8,22.8c0,.45-.1.88-.15,1.28a10.18,10.18,0,0,0-.08,1.27,2.08,2.08,0,0,0,1.16,2.06,6,6,0,0,0,2.67.57,9.48,9.48,0,0,0,1.87-.19,17.19,17.19,0,0,0,1.8-.49l-1.12,5.85c-.75.1-1.5.19-2.25.26a21.2,21.2,0,0,1-2.25.12,20,20,0,0,1-3.38-.27,7.61,7.61,0,0,1-2.74-1,5.52,5.52,0,0,1-1.87-1.91,5.93,5.93,0,0,1-.71-3.08,9.92,9.92,0,0,1,.11-1.57c.07-.5.16-1.05.26-1.65l5.1-24.08h-6.52l1.2-5.62h6.52l2.4-11.48h6.38l-2.4,11.48Z" />
                    <path class="cls-1" d="M1864,179.34l-8.1,38.77h-6.3l8-38.77Zm-5-7,1.65-7.8h6.45l-1.65,7.8Z" />
                    <path class="cls-1"
                      d="M1869.26,193.66a23.64,23.64,0,0,1,4.28-7.8,21.21,21.21,0,0,1,6.82-5.4,20,20,0,0,1,9.11-2q7.88,0,12,4.08t4.13,12a29.67,29.67,0,0,1-1.43,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.69,19.69,0,0,1-9.07,2,18.72,18.72,0,0,1-6.86-1.2,14.26,14.26,0,0,1-8.37-8.44,18.17,18.17,0,0,1-1.12-6.49A29.11,29.11,0,0,1,1869.26,193.66Zm7.61,16.8q2.7,2.92,8,2.93a10.78,10.78,0,0,0,6.19-1.8,16.48,16.48,0,0,0,4.5-4.54,21.36,21.36,0,0,0,2.78-6,22,22,0,0,0,.93-6.08,14.94,14.94,0,0,0-.6-4.27,8.9,8.9,0,0,0-5.06-5.82,11,11,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.61,20.61,0,0,0-2.81,6,23.25,23.25,0,0,0-.94,6.3A10.93,10.93,0,0,0,1876.87,210.46Z" />
                    <path class="cls-1"
                      d="M1923.52,179.34l-1.2,5.85h.15a15.14,15.14,0,0,1,6.08-5.07,18.35,18.35,0,0,1,7.72-1.68c3.65,0,6.37.8,8.14,2.4s2.66,4.12,2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.47,2.78-.82,4.28l-4.73,22.12h-6.37l5-22.65c0-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.27-1.65a10.28,10.28,0,0,0,.11-1.31,4.59,4.59,0,0,0-2-4.09,8.44,8.44,0,0,0-4.8-1.31,11.75,11.75,0,0,0-5.22,1.28,14.81,14.81,0,0,0-4.38,3.22,10.53,10.53,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l8.1-38.77Z" />
                  </g>
                </g>
              </svg>
            </a>
        </div>
        </div>
    </div>
</header>

<main id="main_content">
  <div class="grid-container">
    <h1 aria-label="400 Error">400</h1>
    <h2>bad request</h2>
    <p class="margin-bottom-3 mobile:margin-bottom-6">Sorry, something went wrong. Please try again later.</p>
    <p>Try one of these options instead:</p>
    <div class="margin-bottom-3 mobile:margin-bottom-6">
      <ul class="usa-list usa-list--unstyled flex-wrapper display-block tablet:display-flex">
        <li class="flex-child"><button class="usa-button" id="ncbiHomeBtn">NCBI Home</button></li>
        <li class="flex-child"><button class="usa-button" id="helpDeskBtn">Contact Help Desk</button></li>
        <li class="flex-child flex-fill">
          <form class="usa-search" role="search" method="get" action="https://www.ncbi.nlm.nih.gov/search/all">
            <input class="usa-input" id="basic-search-field-medium" type="search" name="term" placeholder="Search NCBI" aria-label="Search NCBI">
            <button class="usa-button usa-button__reset" type="reset"></button>
            <button class="usa-button usa-button__search" type="submit" aria-label="Search" data-section="link_click" data-ga-action="search_ncbi" data-ga-label="NONE">
              <span aria-hidden="true">Search</span>
            </button>
          </form>
        </li>
      </ul>
    </div>
  </div>
</main>

<footer>
  <section class="icon-section">
    <div id="icon-section-header" class="icon-section_header">Follow NCBI</div>
    <div class="grid-container container">
      <div class="icon-section_container">
        <a class="footer-icon" id="footer_twitter" href="https://twitter.com/ncbi" aria-label="Twitter"><svg
            data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" viewBox="0 0 300 300">
            <defs>
              <style>
                .cls-11 {
                  fill: #737373;
                }
              </style>
            </defs>
            <title>Twitter</title>
            <path class="cls-11"
              d="M250.11,105.48c-7,3.14-13,3.25-19.27.14,8.12-4.86,8.49-8.27,11.43-17.46a78.8,78.8,0,0,1-25,9.55,39.35,39.35,0,0,0-67,35.85,111.6,111.6,0,0,1-81-41.08A39.37,39.37,0,0,0,81.47,145a39.08,39.08,0,0,1-17.8-4.92c0,.17,0,.33,0,.5a39.32,39.32,0,0,0,31.53,38.54,39.26,39.26,0,0,1-17.75.68,39.37,39.37,0,0,0,36.72,27.3A79.07,79.07,0,0,1,56,223.34,111.31,111.31,0,0,0,116.22,241c72.3,0,111.83-59.9,111.83-111.84,0-1.71,0-3.4-.1-5.09C235.62,118.54,244.84,113.37,250.11,105.48Z">
            </path>
          </svg></a>
        <a class="footer-icon" id="footer_facebook" href="https://www.facebook.com/ncbi.nlm" aria-label="Facebook"><svg
            data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" viewBox="0 0 300 300">
            <title>Facebook</title>
            <path class="cls-11"
              d="M210.5,115.12H171.74V97.82c0-8.14,5.39-10,9.19-10h27.14V52l-39.32-.12c-35.66,0-42.42,26.68-42.42,43.77v19.48H99.09v36.32h27.24v109h45.41v-109h35Z">
            </path>
          </svg></a>
        <a class="footer-icon" id="footer_linkedin"
          href="https://www.linkedin.com/company/ncbinlm"
          aria-label="LinkedIn"><svg data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" viewBox="0 0 300 300">
            <title>LinkedIn</title>
            <path class="cls-11"
              d="M101.64,243.37H57.79v-114h43.85Zm-22-131.54h-.26c-13.25,0-21.82-10.36-21.82-21.76,0-11.65,8.84-21.15,22.33-21.15S101.7,78.72,102,90.38C102,101.77,93.4,111.83,79.63,111.83Zm100.93,52.61A17.54,17.54,0,0,0,163,182v61.39H119.18s.51-105.23,0-114H163v13a54.33,54.33,0,0,1,34.54-12.66c26,0,44.39,18.8,44.39,55.29v58.35H198.1V182A17.54,17.54,0,0,0,180.56,164.44Z">
            </path>
          </svg></a>
        <a class="footer-icon" id="footer_github" href="https://github.com/ncbi" aria-label="GitHub"><svg
            data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" viewBox="0 0 300 300">
            <defs>
              <style>
                .cls-11,
                .cls-12 {
                  fill: #737373;
                }

                .cls-11 {
                  fill-rule: evenodd;
                }
              </style>
            </defs>
            <title>GitHub</title>
            <path class="cls-11"
              d="M151.36,47.28a105.76,105.76,0,0,0-33.43,206.1c5.28,1,7.22-2.3,7.22-5.09,0-2.52-.09-10.85-.14-19.69-29.42,6.4-35.63-12.48-35.63-12.48-4.81-12.22-11.74-15.47-11.74-15.47-9.59-6.56.73-6.43.73-6.43,10.61.75,16.21,10.9,16.21,10.9,9.43,16.17,24.73,11.49,30.77,8.79,1-6.83,3.69-11.5,6.71-14.14C108.57,197.1,83.88,188,83.88,147.51a40.92,40.92,0,0,1,10.9-28.39c-1.1-2.66-4.72-13.42,1-28,0,0,8.88-2.84,29.09,10.84a100.26,100.26,0,0,1,53,0C198,88.3,206.9,91.14,206.9,91.14c5.76,14.56,2.14,25.32,1,28a40.87,40.87,0,0,1,10.89,28.39c0,40.62-24.74,49.56-48.29,52.18,3.79,3.28,7.17,9.71,7.17,19.58,0,14.15-.12,25.54-.12,29,0,2.82,1.9,6.11,7.26,5.07A105.76,105.76,0,0,0,151.36,47.28Z">
            </path>
            <path class="cls-12"
              d="M85.66,199.12c-.23.52-1.06.68-1.81.32s-1.2-1.06-.95-1.59,1.06-.69,1.82-.33,1.21,1.07.94,1.6Zm-1.3-1">
            </path>
            <path class="cls-12"
              d="M90,203.89c-.51.47-1.49.25-2.16-.49a1.61,1.61,0,0,1-.31-2.19c.52-.47,1.47-.25,2.17.49s.82,1.72.3,2.19Zm-1-1.08">
            </path>
            <path class="cls-12"
              d="M94.12,210c-.65.46-1.71,0-2.37-.91s-.64-2.07,0-2.52,1.7,0,2.36.89.65,2.08,0,2.54Zm0,0"></path>
            <path class="cls-12"
              d="M99.83,215.87c-.58.64-1.82.47-2.72-.41s-1.18-2.06-.6-2.7,1.83-.46,2.74.41,1.2,2.07.58,2.7Zm0,0">
            </path>
            <path class="cls-12"
              d="M107.71,219.29c-.26.82-1.45,1.2-2.64.85s-2-1.34-1.74-2.17,1.44-1.23,2.65-.85,2,1.32,1.73,2.17Zm0,0">
            </path>
            <path class="cls-12"
              d="M116.36,219.92c0,.87-1,1.59-2.24,1.61s-2.29-.68-2.3-1.54,1-1.59,2.26-1.61,2.28.67,2.28,1.54Zm0,0">
            </path>
            <path class="cls-12"
              d="M124.42,218.55c.15.85-.73,1.72-2,1.95s-2.37-.3-2.52-1.14.73-1.75,2-2,2.37.29,2.53,1.16Zm0,0"></path>
          </svg></a>
        <a class="footer-icon" id="footer_blog" href="https://ncbiinsights.ncbi.nlm.nih.gov/" aria-label="Blog">
          <svg id="Layer_1" data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" viewBox="0 0 40 40"><defs><style>.cls-13{fill:#737373;}</style></defs><path class="cls-13" d="M14,30a4,4,0,1,1-4-4,4,4,0,0,1,4,4Zm11,3A19,19,0,0,0,7.05,15a1,1,0,0,0-1,1v3a1,1,0,0,0,.93,1A14,14,0,0,1,20,33.07,1,1,0,0,0,21,34h3a1,1,0,0,0,1-1Zm9,0A28,28,0,0,0,7,6,1,1,0,0,0,6,7v3a1,1,0,0,0,1,1A23,23,0,0,1,29,33a1,1,0,0,0,1,1h3A1,1,0,0,0,34,33Z"/></svg>
        </a>
      </div>
    </div>
  </section>

  <section class="container-fluid bg-primary">
    <div class="container pt-5">
      <div class="row mt-3">
        <div class="col-lg-3 col-12">
          <p><a class="text-white" href="https://www.nlm.nih.gov/socialmedia/index.html">Connect with NLM</a></p>
          <ul class="list-inline social_media">
            <li class="list-inline-item"><a href="https://twitter.com/NLM_NIH" aria-label="Twitter"
                target="_blank" rel="noopener noreferrer"><svg version="1.1" xmlns="http://www.w3.org/2000/svg"
                  xmlns:xlink="http://www.w3.org/1999/xlink" x="0px" y="0px" viewBox="0 0 249 249"
                  style="enable-background:new 0 0 249 249;" xml:space="preserve">
                  <style type="text/css">
                    .st20 {
                      fill: #FFFFFF;
                    }

                    .st30 {
                      fill: none;
                      stroke: #FFFFFF;
                      stroke-width: 8;
                      stroke-miterlimit: 10;
                    }
                  </style>
                  <title>SM-Twitter</title>
                  <g>
                    <g>
                      <g>
                        <path class="st20" d="M192.9,88.1c-5,2.2-9.2,2.3-13.6,0.1c5.7-3.4,6-5.8,8.1-12.3c-5.4,3.2-11.4,5.5-17.6,6.7
                                            c-10.5-11.2-28.1-11.7-39.2-1.2c-7.2,6.8-10.2,16.9-8,26.5c-22.3-1.1-43.1-11.7-57.2-29C58,91.6,61.8,107.9,74,116
                                            c-4.4-0.1-8.7-1.3-12.6-3.4c0,0.1,0,0.2,0,0.4c0,13.2,9.3,24.6,22.3,27.2c-4.1,1.1-8.4,1.3-12.5,0.5c3.6,11.3,14,19,25.9,19.3
                                            c-11.6,9.1-26.4,13.2-41.1,11.5c12.7,8.1,27.4,12.5,42.5,12.5c51,0,78.9-42.2,78.9-78.9c0-1.2,0-2.4-0.1-3.6
                                            C182.7,97.4,189.2,93.7,192.9,88.1z"></path>
                      </g>
                    </g>
                    <circle class="st30" cx="124.4" cy="128.8" r="108.2"></circle>
                  </g>
                </svg></a></li>
            <li class="list-inline-item"><a href="https://www.facebook.com/nationallibraryofmedicine"
                aria-label="Facebook" rel="noopener noreferrer" target="_blank">
                <svg version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink" x="0px"
                  y="0px" viewBox="0 0 249 249" style="enable-background:new 0 0 249 249;" xml:space="preserve">
                  <style type="text/css">
                    .st10 {
                      fill: #FFFFFF;
                    }

                    .st110 {
                      fill: none;
                      stroke: #FFFFFF;
                      stroke-width: 8;
                      stroke-miterlimit: 10;
                    }
                  </style>
                  <title>SM-Facebook</title>
                  <g>
                    <g>
                      <path class="st10" d="M159,99.1h-24V88.4c0-5,3.3-6.2,5.7-6.2h16.8V60l-24.4-0.1c-22.1,0-26.2,16.5-26.2,27.1v12.1H90v22.5h16.9
                                                  v67.5H135v-67.5h21.7L159,99.1z"></path>
                    </g>
                  </g>
                  <circle class="st110" cx="123.6" cy="123.2" r="108.2"></circle>
                </svg>
              </a></li>
            <li class="list-inline-item"><a href="https://www.youtube.com/user/NLMNIH" aria-label="Youtube"
                target="_blank" rel="noopener noreferrer"><svg version="1.1" xmlns="http://www.w3.org/2000/svg"
                  xmlns:xlink="http://www.w3.org/1999/xlink" x="0px" y="0px" viewBox="0 0 249 249"
                  style="enable-background:new 0 0 249 249;" xml:space="preserve">
                  <title>SM-Youtube</title>
                  <style type="text/css">
                    .st4 {
                      fill: none;
                      stroke: #FFFFFF;
                      stroke-width: 8;
                      stroke-miterlimit: 10;
                    }

                    .st5 {
                      fill: #FFFFFF;
                    }
                  </style>
                  <circle class="st4" cx="124.2" cy="123.4" r="108.2"></circle>
                  <g transform="translate(0,-952.36218)">
                    <path class="st5"
                      d="M88.4,1037.4c-10.4,0-18.7,8.3-18.7,18.7v40.1c0,10.4,8.3,18.7,18.7,18.7h72.1c10.4,0,18.7-8.3,18.7-18.7
                                        v-40.1c0-10.4-8.3-18.7-18.7-18.7H88.4z M115.2,1058.8l29.4,17.4l-29.4,17.4V1058.8z"></path>
                  </g>
                </svg></a></li>
          </ul>
        </div>
        <div class="col-lg-3 col-12">
          <p class="address_footer text-white">National Library of Medicine<br>
            <a href="https://www.google.com/maps/place/8600+Rockville+Pike,+Bethesda,+MD+20894/@38.9959508,-77.101021,17z/data=!3m1!4b1!4m5!3m4!1s0x89b7c95e25765ddb:0x19156f88b27635b8!8m2!3d38.9959508!4d-77.0988323"
              class="text-white" target="_blank" rel="noopener noreferrer">8600 Rockville Pike<br>
              Bethesda, MD 20894</a></p>
        </div>
        <div class="col-lg-3 col-12 centered-lg">
          <p><a href="https://www.nlm.nih.gov/web_policies.html" class="text-white">Web Policies</a><br>
            <a href="https://www.nih.gov/institutes-nih/nih-office-director/office-communications-public-liaison/freedom-information-act-office"
              class="text-white">FOIA</a><br>
            <a href="https://www.hhs.gov/vulnerability-disclosure-policy/index.html" class="text-white" id="vdp">HHS Vulnerability Disclosure</a></p>
        </div>
        <div class="col-lg-3 col-12 centered-lg">
          <p><a class="supportLink text-white" href="https://support.nlm.nih.gov/">Help</a><br>
            <a href="https://www.nlm.nih.gov/accessibility.html" class="text-white">Accessibility</a><br>
            <a href="https://www.nlm.nih.gov/careers/careers.html" class="text-white">Careers</a></p>
        </div>
      </div>
      <div class="row">
        <div class="col-lg-12 centered-lg">
          <nav class="bottom-links">
            <ul class="mt-3">
              <li>
                <a class="text-white" href="//www.nlm.nih.gov/">NLM</a>
              </li>
              <li>
                <a class="text-white"
              href="https://www.nih.gov/">NIH</a>
              </li>
              <li>
                <a class="text-white" href="https://www.hhs.gov/">HHS</a>
              </li>
              <li>
                <a
              class="text-white" href="https://www.usa.gov/">USA.gov</a>
              </li>
            </ul>
          </nav>
        </div>
      </div>
    </div>
  </section>
</footer>

</body>
<script>
  const userEvents =  ['click', 'keypress'];
  for (let i = 0; i < userEvents.length; i++) {
    let evt = userEvents[i];
    document.querySelector('#icon-section-header').addEventListener(evt, function(e){
      if (document.body.clientWidth < 993) {
        classToggle(e.target);
      }
    });
  }
  function classToggle(elm) {
    elm.classList.toggle('opened');
  }
  let helpDeskBtn = document.querySelector('#helpDeskBtn');
  if (!!helpDeskBtn) {
    let helpDeskLink = 'https://support.nlm.nih.gov/support/create-case?from=' + encodeURIComponent(window.location.href);
    helpDeskBtn.addEventListener('click',  function(){
      window.open(helpDeskLink, '_blank')
    });
  }
  let ncbiHomeBtn = document.querySelector('#ncbiHomeBtn');
  if (!!ncbiHomeBtn) {
    ncbiHomeBtn.addEventListener('click', function(){
      window.open('https://www.ncbi.nlm.nih.gov', '_blank')
    });
  }
  // Following JavaScript is to toggle top banner of page.
  var head_bnr = document.querySelector(".usa-banner header.usa-banner-header");
  var btn_bnr = document.querySelector(".usa-banner button.usa-accordion-button.usa-banner-button");
  var acr_bnr = document.querySelector(".usa-banner div.usa-banner-content.usa-accordion-content");
  btn_bnr.addEventListener("click", function(e) {
    head_bnr.classList.toggle("usa-banner-header-expanded");
    var aria_val = this.getAttribute("aria-expanded");
    var opp_aria_val = (aria_val === "false") ? "true" : "false";
    this.setAttribute("aria-expanded", opp_aria_val);
    acr_bnr.setAttribute("aria-hidden", aria_val);
    e.stopPropagation();
  });
</script>
</html>

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.