Viewing data for Lampetra aepyptera


Scientific name Lampetra aepyptera
Common name Least brook lamprey
Maximum lifespan 8.00 years (Lampetra aepyptera@AnAge)

Total mtDNA (size: 16236 bases) GC AT G C A T
Base content (bases) 6228 10008 3932 2296 4861 5147
Base content per 1 kb (bases) 384 616 242 141 299 317
Base content (%) 38.4% 61.6%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 4347 7031 2851 1496 3501 3530
Base content per 1 kb (bases) 382 618 251 131 308 310
Base content (%) 38.2% 61.8%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1530 bases) GC AT G C A T
Base content (bases) 602 928 340 262 426 502
Base content per 1 kb (bases) 393 607 222 171 278 328
Base content (%) 39.3% 60.7%
Total rRNA-coding genes (size: 2518 bases) GC AT G C A T
Base content (bases) 1027 1491 578 449 605 886
Base content per 1 kb (bases) 408 592 230 178 240 352
Base content (%) 40.8% 59.2%
12S rRNA gene (size: 902 bases) GC AT G C A T
Base content (bases) 407 495 239 168 198 297
Base content per 1 kb (bases) 451 549 265 186 220 329
Base content (%) 45.1% 54.9%
16S rRNA gene (size: 1616 bases) GC AT G C A T
Base content (bases) 620 996 339 281 407 589
Base content per 1 kb (bases) 384 616 210 174 252 364
Base content (%) 38.4% 61.6%

ATP6 (size: 679 bases) GC AT G C A T
Base content (bases) 249 430 176 73 219 211
Base content per 1 kb (bases) 367 633 259 108 323 311
Base content (%) 36.7% 63.3%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 62 106 48 14 48 58
Base content per 1 kb (bases) 369 631 286 83 286 345
Base content (%) 36.9% 63.1%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 612 942 365 247 502 440
Base content per 1 kb (bases) 394 606 235 159 323 283
Base content (%) 39.4% 60.6%
COX2 (size: 690 bases) GC AT G C A T
Base content (bases) 256 434 156 100 216 218
Base content per 1 kb (bases) 371 629 226 145 313 316
Base content (%) 37.1% 62.9%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 334 452 208 126 235 217
Base content per 1 kb (bases) 425 575 265 160 299 276
Base content (%) 42.5% 57.5%
CYTB (size: 1191 bases) GC AT G C A T
Base content (bases) 462 729 281 181 398 331
Base content per 1 kb (bases) 388 612 236 152 334 278
Base content (%) 38.8% 61.2%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 367 599 220 147 325 274
Base content per 1 kb (bases) 380 620 228 152 336 284
Base content (%) 38.0% 62.0%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 391 651 268 123 312 339
Base content per 1 kb (bases) 375 625 257 118 299 325
Base content (%) 37.5% 62.5%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 148 203 100 48 114 89
Base content per 1 kb (bases) 422 578 285 137 325 254
Base content (%) 42.2% 57.8%
ND4 (size: 1377 bases) GC AT G C A T
Base content (bases) 504 873 361 143 440 433
Base content per 1 kb (bases) 366 634 262 104 320 314
Base content (%) 36.6% 63.4%
ND4L (size: 291 bases) GC AT G C A T
Base content (bases) 111 180 78 33 90 90
Base content per 1 kb (bases) 381 619 268 113 309 309
Base content (%) 38.1% 61.9%
ND5 (size: 1797 bases) GC AT G C A T
Base content (bases) 664 1133 457 207 534 599
Base content per 1 kb (bases) 370 630 254 115 297 333
Base content (%) 37.0% 63.0%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 202 317 141 61 76 241
Base content per 1 kb (bases) 389 611 272 118 146 464
Base content (%) 38.9% 61.1%

ATP6 (size: 679 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.56%)
Alanine (Ala, A)
n = 19 (8.44%)
Serine (Ser, S)
n = 9 (4.0%)
Threonine (Thr, T)
n = 25 (11.11%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 9 (4.0%)
Leucine (Leu, L)
n = 51 (22.67%)
Isoleucine (Ile, I)
n = 23 (10.22%)
Methionine (Met, M)
n = 15 (6.67%)
Proline (Pro, P)
n = 15 (6.67%)
Phenylalanine (Phe, F)
n = 9 (4.0%)
Tyrosine (Tyr, Y)
n = 5 (2.22%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 5 (2.22%)
Asparagine (Asn, N)
n = 7 (3.11%)
Glutamine (Gln, Q)
n = 9 (4.0%)
Histidine (His, H)
n = 4 (1.78%)
Lysine (Lys, K)
n = 5 (2.22%)
Arginine (Arg, R)
n = 3 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 11 11 9 6 18 0 16 9 0 2 5 2 0 9 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 8 5 5 1 0 2 3 3 5 1 6 3 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 0 3 1 3 0 1 1 4 1 0 2 4 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 1 1 0 5 0 0 1 2 0 0 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 64 77 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
17 66 36 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 46 98 68
ATP8 (size: 168 bases)
Amino acid sequence: MPQLEPAPWFSMLTVSWLIILLLIMPTIMFYQTQNTISAQQATKPKQPTWTWPWH*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 7 (12.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 4 (7.27%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 1 (1.82%)
Glutamine (Gln, Q)
n = 6 (10.91%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 2 2 0 1 0 3 6 0 0 0 1 0 2 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 1 0 0 0 0 0 0 1 3 3 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 2 0 1 0 0 0 0 1 0 0 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 1 0 0 2 0 0 0 0 0 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 17 19 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 20 13 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 11 26 15
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 44 (8.51%)
Alanine (Ala, A)
n = 45 (8.7%)
Serine (Ser, S)
n = 29 (5.61%)
Threonine (Thr, T)
n = 40 (7.74%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.54%)
Leucine (Leu, L)
n = 62 (11.99%)
Isoleucine (Ile, I)
n = 39 (7.54%)
Methionine (Met, M)
n = 27 (5.22%)
Proline (Pro, P)
n = 28 (5.42%)
Phenylalanine (Phe, F)
n = 41 (7.93%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 16 (3.09%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 17 (3.29%)
Glutamine (Gln, Q)
n = 7 (1.35%)
Histidine (His, H)
n = 18 (3.48%)
Lysine (Lys, K)
n = 11 (2.13%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 15 25 21 3 16 1 21 7 0 18 4 12 5 23 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 15 17 13 0 4 10 26 4 6 5 15 2 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 17 2 6 6 12 0 1 4 10 9 0 0 9 8 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 0 6 10 10 1 5 0 2 1 1 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 102 140 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 137 97 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 126 203 171
COX2 (size: 690 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 13 (5.68%)
Serine (Ser, S)
n = 19 (8.3%)
Threonine (Thr, T)
n = 16 (6.99%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 16 (6.99%)
Leucine (Leu, L)
n = 25 (10.92%)
Isoleucine (Ile, I)
n = 22 (9.61%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 13 (5.68%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 15 (6.55%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 8 (3.49%)
Lysine (Lys, K)
n = 3 (1.31%)
Arginine (Arg, R)
n = 7 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 7 9 8 2 10 0 5 7 2 8 1 7 0 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 3 3 7 0 2 3 4 0 4 0 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 8 0 6 5 3 0 5 0 6 4 0 0 3 1 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 13 2 8 4 3 0 1 3 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 57 62 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 56 62 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 43 94 86
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.28%)
Alanine (Ala, A)
n = 22 (8.43%)
Serine (Ser, S)
n = 16 (6.13%)
Threonine (Thr, T)
n = 23 (8.81%)
Cysteine (Cys, C)
n = 3 (1.15%)
Valine (Val, V)
n = 18 (6.9%)
Leucine (Leu, L)
n = 35 (13.41%)
Isoleucine (Ile, I)
n = 11 (4.21%)
Methionine (Met, M)
n = 11 (4.21%)
Proline (Pro, P)
n = 11 (4.21%)
Phenylalanine (Phe, F)
n = 20 (7.66%)
Tyrosine (Tyr, Y)
n = 12 (4.6%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 4 (1.53%)
Glutamic acid (Glu, E)
n = 9 (3.45%)
Asparagine (Asn, N)
n = 4 (1.53%)
Glutamine (Gln, Q)
n = 7 (2.68%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 4 7 7 1 19 2 5 7 0 7 2 7 2 13 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 4 10 8 0 4 11 4 0 0 3 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 10 0 6 3 2 1 1 3 6 6 0 1 2 2 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 1 2 2 3 0 0 1 4 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 68 56 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 56 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 72 105 74
CYTB (size: 1191 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (7.07%)
Alanine (Ala, A)
n = 31 (7.83%)
Serine (Ser, S)
n = 25 (6.31%)
Threonine (Thr, T)
n = 23 (5.81%)
Cysteine (Cys, C)
n = 3 (0.76%)
Valine (Val, V)
n = 22 (5.56%)
Leucine (Leu, L)
n = 55 (13.89%)
Isoleucine (Ile, I)
n = 38 (9.6%)
Methionine (Met, M)
n = 16 (4.04%)
Proline (Pro, P)
n = 22 (5.56%)
Phenylalanine (Phe, F)
n = 31 (7.83%)
Tyrosine (Tyr, Y)
n = 13 (3.28%)
Tryptophan (Trp, W)
n = 12 (3.03%)
Aspartic acid (Asp, D)
n = 8 (2.02%)
Glutamic acid (Glu, E)
n = 7 (1.77%)
Asparagine (Asn, N)
n = 22 (5.56%)
Glutamine (Gln, Q)
n = 8 (2.02%)
Histidine (His, H)
n = 13 (3.28%)
Lysine (Lys, K)
n = 10 (2.53%)
Arginine (Arg, R)
n = 9 (2.27%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 8 12 11 6 17 3 16 8 0 10 3 7 2 20 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 0 7 12 11 1 5 9 7 7 6 2 14 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 0 10 2 7 2 2 2 8 5 1 2 10 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 3 4 4 8 2 2 2 4 1 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
96 89 114 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 97 81 162
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 95 136 138
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (6.23%)
Alanine (Ala, A)
n = 28 (8.72%)
Serine (Ser, S)
n = 24 (7.48%)
Threonine (Thr, T)
n = 21 (6.54%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 23 (7.17%)
Leucine (Leu, L)
n = 60 (18.69%)
Isoleucine (Ile, I)
n = 22 (6.85%)
Methionine (Met, M)
n = 16 (4.98%)
Proline (Pro, P)
n = 17 (5.3%)
Phenylalanine (Phe, F)
n = 21 (6.54%)
Tyrosine (Tyr, Y)
n = 9 (2.8%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 10 (3.12%)
Asparagine (Asn, N)
n = 13 (4.05%)
Glutamine (Gln, Q)
n = 9 (2.8%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.18%)
Arginine (Arg, R)
n = 7 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 10 12 17 5 12 6 18 8 1 7 2 14 0 16 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 8 6 13 1 4 2 10 4 5 4 8 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 5 1 7 3 10 1 0 3 5 4 0 2 9 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 9 1 1 2 5 2 0 1 5 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 75 82 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 87 54 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 58 138 102
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.2%)
Alanine (Ala, A)
n = 31 (8.96%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 36 (10.4%)
Cysteine (Cys, C)
n = 4 (1.16%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 61 (17.63%)
Isoleucine (Ile, I)
n = 35 (10.12%)
Methionine (Met, M)
n = 24 (6.94%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 12 (3.47%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 13 20 20 4 19 3 14 12 0 3 0 3 1 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 4 0 12 7 12 0 2 10 3 3 3 3 13 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 19 0 5 1 12 0 2 7 3 3 1 1 10 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 0 2 1 8 2 2 1 1 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 88 131 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 104 59 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 76 149 107
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.2%)
Alanine (Ala, A)
n = 31 (8.96%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 36 (10.4%)
Cysteine (Cys, C)
n = 4 (1.16%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 61 (17.63%)
Isoleucine (Ile, I)
n = 35 (10.12%)
Methionine (Met, M)
n = 24 (6.94%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 12 (3.47%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 13 20 20 4 19 3 14 12 0 3 0 3 1 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 4 0 12 7 12 0 2 10 3 3 3 3 13 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 19 0 5 1 12 0 2 7 3 3 1 1 10 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 0 2 1 8 2 2 1 1 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 88 131 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 104 59 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 76 149 107
ND4 (size: 1377 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (3.28%)
Alanine (Ala, A)
n = 35 (7.64%)
Serine (Ser, S)
n = 40 (8.73%)
Threonine (Thr, T)
n = 41 (8.95%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 82 (17.9%)
Isoleucine (Ile, I)
n = 48 (10.48%)
Methionine (Met, M)
n = 37 (8.08%)
Proline (Pro, P)
n = 24 (5.24%)
Phenylalanine (Phe, F)
n = 24 (5.24%)
Tyrosine (Tyr, Y)
n = 8 (1.75%)
Tryptophan (Trp, W)
n = 14 (3.06%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 17 (3.71%)
Glutamine (Gln, Q)
n = 9 (1.97%)
Histidine (His, H)
n = 13 (2.84%)
Lysine (Lys, K)
n = 12 (2.62%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 16 35 19 10 26 2 22 9 0 3 1 2 3 13 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 4 10 17 8 0 1 7 6 1 6 6 11 1 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 18 0 11 3 14 2 2 8 5 3 0 3 9 8 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 0 0 5 12 0 2 2 5 0 1 0 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 112 166 107
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 130 74 200
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 119 193 133
ND4L (size: 291 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.13%)
Alanine (Ala, A)
n = 12 (12.5%)
Serine (Ser, S)
n = 8 (8.33%)
Threonine (Thr, T)
n = 9 (9.38%)
Cysteine (Cys, C)
n = 2 (2.08%)
Valine (Val, V)
n = 1 (1.04%)
Leucine (Leu, L)
n = 26 (27.08%)
Isoleucine (Ile, I)
n = 4 (4.17%)
Methionine (Met, M)
n = 6 (6.25%)
Proline (Pro, P)
n = 3 (3.13%)
Phenylalanine (Phe, F)
n = 4 (4.17%)
Tyrosine (Tyr, Y)
n = 1 (1.04%)
Tryptophan (Trp, W)
n = 1 (1.04%)
Aspartic acid (Asp, D)
n = 1 (1.04%)
Glutamic acid (Glu, E)
n = 2 (2.08%)
Asparagine (Asn, N)
n = 4 (4.17%)
Glutamine (Gln, Q)
n = 2 (2.08%)
Histidine (His, H)
n = 2 (2.08%)
Lysine (Lys, K)
n = 3 (3.13%)
Arginine (Arg, R)
n = 2 (2.08%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 4 6 0 6 3 11 2 0 0 1 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 2 5 5 0 0 2 1 0 0 1 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 0 3 1 3 0 0 1 1 0 0 0 0 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 3 0 1 0 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 24 27 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 31 16 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 23 47 22
ND5 (size: 1797 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (3.85%)
Alanine (Ala, A)
n = 44 (7.36%)
Serine (Ser, S)
n = 48 (8.03%)
Threonine (Thr, T)
n = 58 (9.7%)
Cysteine (Cys, C)
n = 7 (1.17%)
Valine (Val, V)
n = 13 (2.17%)
Leucine (Leu, L)
n = 92 (15.38%)
Isoleucine (Ile, I)
n = 60 (10.03%)
Methionine (Met, M)
n = 39 (6.52%)
Proline (Pro, P)
n = 29 (4.85%)
Phenylalanine (Phe, F)
n = 34 (5.69%)
Tyrosine (Tyr, Y)
n = 13 (2.17%)
Tryptophan (Trp, W)
n = 14 (2.34%)
Aspartic acid (Asp, D)
n = 10 (1.67%)
Glutamic acid (Glu, E)
n = 14 (2.34%)
Asparagine (Asn, N)
n = 32 (5.35%)
Glutamine (Gln, Q)
n = 18 (3.01%)
Histidine (His, H)
n = 13 (2.17%)
Lysine (Lys, K)
n = 26 (4.35%)
Arginine (Arg, R)
n = 11 (1.84%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
39 21 35 17 11 36 6 20 15 3 5 1 7 0 19 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 4 12 18 13 1 2 6 13 2 3 10 13 3 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 27 2 12 9 12 1 8 6 8 5 1 2 16 16 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 4 6 4 24 2 3 2 5 1 0 1 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
104 141 230 124
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 165 126 238
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 151 243 172
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (11.05%)
Alanine (Ala, A)
n = 15 (8.72%)
Serine (Ser, S)
n = 10 (5.81%)
Threonine (Thr, T)
n = 4 (2.33%)
Cysteine (Cys, C)
n = 7 (4.07%)
Valine (Val, V)
n = 28 (16.28%)
Leucine (Leu, L)
n = 28 (16.28%)
Isoleucine (Ile, I)
n = 5 (2.91%)
Methionine (Met, M)
n = 7 (4.07%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 19 (11.05%)
Tyrosine (Tyr, Y)
n = 9 (5.23%)
Tryptophan (Trp, W)
n = 3 (1.74%)
Aspartic acid (Asp, D)
n = 4 (2.33%)
Glutamic acid (Glu, E)
n = 3 (1.74%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 3 3 0 0 2 15 0 0 15 2 6 5 16 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 7 0 11 3 1 0 4 2 3 10 4 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 5 0 2 0 2 1 6 3 2 8 1 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 3 3 1 0 0 2 0 1 1 1 0 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 14 22 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 30 19 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 17 35 86
Total protein-coding genes (size: 11411 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 211 (5.55%)
Alanine (Ala, A)
n = 306 (8.05%)
Serine (Ser, S)
n = 268 (7.05%)
Threonine (Thr, T)
n = 309 (8.13%)
Cysteine (Cys, C)
n = 38 (1.0%)
Valine (Val, V)
n = 189 (4.97%)
Leucine (Leu, L)
n = 610 (16.04%)
Isoleucine (Ile, I)
n = 320 (8.42%)
Methionine (Met, M)
n = 218 (5.73%)
Proline (Pro, P)
n = 200 (5.26%)
Phenylalanine (Phe, F)
n = 236 (6.21%)
Tyrosine (Tyr, Y)
n = 108 (2.84%)
Tryptophan (Trp, W)
n = 109 (2.87%)
Aspartic acid (Asp, D)
n = 71 (1.87%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 142 (3.73%)
Glutamine (Gln, Q)
n = 98 (2.58%)
Histidine (His, H)
n = 99 (2.6%)
Lysine (Lys, K)
n = 94 (2.47%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
209 111 178 148 50 190 30 171 91 7 80 22 69 18 148 88
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
40 23 15 97 106 99 4 28 66 83 34 43 40 107 10 97
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
72 135 5 80 38 81 8 25 36 63 45 5 21 73 69 36
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
63 79 16 35 36 85 9 18 14 33 6 4 1 4 2 104
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
872 886 1149 896
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
495 1022 713 1573
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
216 871 1513 1203

<!DOCTYPE html>
<html lang="en" >
<head >
    <meta charset="UTF-8">
    <meta http-equiv="X-UA-Compatible" content="IE=edge">
    <meta name="HandheldFriendly" content="True">
    <meta name="MobileOptimized" content="320">
    <meta name="viewport" content="width=device-width, initial-scale=1.0">
    <title>400 Error - NCBI</title>
    <meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no">
    <meta http-equiv="X-UA-Compatible" content="IE=edge" />
    <meta http-equiv="Content-Type" content="text/html; charset=utf-8" />
    <meta http-equiv="X-UA-Compatible" content="IE=edge,chrome=1" />
    <meta name="title" content="400 Error - NCBI">
    <meta name="robots" content="noindex">
    <meta name="googlebot" content="noindex">
    <style>

      /* USWDS Banner Styles */
      .usa-banner{
        background-color:#f1f1f1;
        padding-bottom:0.7rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner{
          font-size:1.3rem;
          padding-bottom:0;
        }
      }

      .usa-banner .usa-accordion, .usa-banner .usa-accordion-bordered{
        margin-top:0;
        margin-bottom:0;
        list-style-type:none;
        padding-left:0;
        color:#212121;
        margin:0;
        padding:0;
        width:100%;
      }

      .usa-banner .usa-banner-header{
        padding-top:0.55rem;
        padding-bottom:0.55rem;
        font-size:0.75rem;
        font-weight:400;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header{
          padding-top:0;
          padding-bottom:0;
        }
      }

      .usa-banner .usa-banner-inner{
        max-width:1040px;
        margin-left:auto;
        margin-right:auto;
        padding-right:1.5rem;
        padding-left:1.5rem;
      }

      .usa-banner .usa-banner-inner::after{
        clear:both;
        content:"";
        display:block;
      }

      @media screen and (min-width: 951px){
        .usa-banner .usa-banner-inner{
          padding-right:3rem;
          padding-left:3rem;
        }
      }

      .usa-banner .usa-banner-header-expanded{
        -ms-flex-align:center;
        align-items:center;
        border-bottom:1px solid #aeb0b5;
        display:-ms-flexbox;
        display:flex;
        font-size:0.75rem;
        min-height:0rem;
        padding-right:3rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header-expanded{
          border-bottom:none;
          display:block;
          font-size:0.75rem;
          font-weight:400;
          min-height:0;
          padding-right:0;
        }
      }

      .usa-banner .usa-banner-header-expanded > .usa-banner-inner{
        margin-left:0;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header-expanded > .usa-banner-inner{
          margin-left:auto;
        }
      }

      .usa-banner .usa-section > :first-child,
      .usa-banner .usa-grid > :first-child,
      .usa-banner .usa-grid-full > :first-child{
        margin-top:0;
      }

      .usa-banner .usa-section > :last-child,
      .usa-banner .usa-grid > :last-child,
      .usa-banner .usa-grid-full > :last-child{
        margin-bottom:0;
      }

      .usa-banner img{
        border:0;
      }

      .usa-banner img{
        max-width:100%;
      }

      .usa-banner .usa-banner-header img{
        float:left;
        margin-right:1rem;
        margin-top:1px;
        width:1.5rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header img{
          margin-right:0.7rem;
          width:1.3rem;
        }
      }

      .usa-banner .usa-banner-header-expanded img{
        margin-right:1rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header-expanded img{
          margin-right:0.7rem;
        }
      }

      .usa-banner p{
        line-height:1.5;
        /*margin-bottom:1em;
        margin-top:1em;*/
      }

      .usa-banner .usa-banner-header p{
        margin-top:0;
        margin-bottom:0;
        display:inline;
        overflow:hidden;
        vertical-align:middle;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header p{
          margin-top:2px;
          margin-bottom:2px;
          display:inline-block;
        }
      }

      .usa-banner .usa-banner-header-expanded p{
        line-height:1.3;
        vertical-align:top;
        font-size: 0.95rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-header-expanded p{
          line-height:1.5;
          vertical-align:middle;
          font-size: 0.75rem;
        }
      }

      .usa-banner .usa-accordion-button.usa-banner-button{
        background-color:transparent;
        border:0;
        border-radius:0;
        font-weight:400;
        margin:0;
        padding:0;
        text-align:left;
        -webkit-font-smoothing:auto;
        padding-top:0;
        padding-left:4.0rem;
        background-position-x:right;
        color:#0071bc;
        display:block;
        font-size:0.7rem;
        height:4.3rem;
        left:0;
        position:absolute;
        text-decoration:underline;
        top:0;
        width:100%;
      }

      .usa-banner .usa-banner-button:hover{
        background-color:transparent;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-accordion-button.usa-banner-button{
          padding-top:0;
          padding-left:0;
          display:inline;
          height:auto;
          margin-left:3px;
          position:relative;
          vertical-align:middle;
          width:auto;
        }
      }

      .usa-banner .usa-accordion-button.usa-banner-button:hover{
        color:#205493;
        text-decoration:underline;
      }

      .usa-banner .usa-accordion-button.usa-banner-button[aria-expanded=false]{
        background-image:none;
      }

      .usa-banner .usa-banner-button[aria-expanded=false]::after{
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-down-primary.png");
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-down-primary.svg");
        background-size:100%;
        content:'';
        display:inline-block;
        height:0.7rem;
        width:0.7rem;
        margin-left:0;
      }

      .usa-banner .usa-banner-button[aria-expanded=false]:hover::after{
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-down-primary-hover.png");
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-down-primary-hover.svg");
      }

      .usa-banner .usa-banner-button[aria-expanded=false]::after{
        background-position-y:1px;
      }

      .usa-banner .usa-banner-button[aria-expanded=true]{
        background-image:none;
        height:3.1rem;
      }

      .usa-banner .usa-banner-button[aria-expanded=true]::after{
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/close.png");
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/close.svg");
        background-size:100%;
        content:'';
        display:inline-block;
        height:0.9rem;
        width:0.9rem;
        margin-left:0;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-button[aria-expanded=true]{
          height:initial;
          padding:0;
          position:relative;
        }
        .usa-banner .usa-banner-button[aria-expanded=true]::after{
          background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-up-primary.png");
          background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-up-primary.svg");
          background-size:100%;
          content:'';
          display:inline-block;
          height:0.7rem;
          width:0.7rem;
          margin-left:0;
        }
        .usa-banner .usa-banner-button[aria-expanded=true]:hover::after{
          background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-up-primary-hover.png");
          background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/angle-arrow-up-primary-hover.svg");
        }
        .usa-banner .usa-banner-button[aria-expanded=true]::after{
          background-position-y:1px;
        }
      }

      .usa-banner .usa-banner-button[aria-expanded=true]::after{
        position:absolute;
        right:1.0rem;
        top:1.15rem;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-button[aria-expanded=true]::after{
          position:static;
        }
      }

      .usa-banner .usa-banner-button[aria-expanded=true] .usa-banner-button-text{
        display:none;
      }

      @media screen and (min-width: 481px){
        .usa-banner .usa-banner-button[aria-expanded=true] .usa-banner-button-text{
          display:inline;
        }
      }

      .usa-banner .usa-accordion-button{
        background-color:transparent;
        border:0;
        border-radius:0;
        font-weight:400;
        margin:0;
        padding:0;
        text-align:left;
        -webkit-font-smoothing:auto;
        background-color:#f1f1f1;
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/minus.png");
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/minus.svg");
        background-position:right 2rem center;
        background-repeat:no-repeat;
        background-size:1.5rem;
        color:#212121;
        cursor:pointer;
        display:inline-block;
        font-family:"Source Sans Pro", "Helvetica Neue", "Helvetica", "Roboto", "Arial", sans-serif;
        font-weight:700;
        margin:0;
        padding:1.5rem 5.5rem 1.5rem 2rem;
        width:100%;
      }

      .usa-banner .usa-accordion-button:hover{
        background-color:transparent;
      }

      .usa-banner .usa-accordion-button:hover{
        /*background-color:#d6d7d9;*/
        color:#212121;
      }

      .usa-banner .usa-accordion-button h1,
      .usa-banner .usa-accordion-button h2,
      .usa-banner .usa-accordion-button h3,
      .usa-banner .usa-accordion-button h4,
      .usa-banner .usa-accordion-button h5,
      .usa-banner .usa-accordion-button h6{
        margin:0;
      }

      .usa-banner .usa-accordion-button[aria-expanded=false]{
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/plus.png");
        background-image:url("https://www.ncbi.nlm.nih.gov/style-guide/static/django_uswds/uswds/img/plus.svg");
        background-repeat:no-repeat;
        background-size:1.5rem;
      }

      .usa-banner .usa-accordion-content.usa-banner-content{
        padding-right:1.5rem;
        padding-bottom:3px;
        padding-left:1.5rem;
        background-color:transparent;
        font-size:0.9375rem;
        padding-top:1.5rem;
        width:100%;
      }

      @media screen and (min-width: 600px){
        .usa-banner .usa-accordion-content.usa-banner-content{
          padding-bottom:2rem;
          padding-top:2rem;
        }
      }

      @media screen and (min-width: 951px){
        .usa-banner .usa-accordion-content.usa-banner-content{
          padding-right:1.2rem;
          padding-left:1.2rem;
        }
      }

      .usa-banner .usa-banner-content p:first-child{
        margin-top:1rem;
      }

      @media screen and (min-width: 600px){
        .usa-banner .usa-banner-content p:first-child{
          margin-top:0;
        }
      }

      .usa-banner .usa-accordion-bordered .usa-accordion-content{
        border-bottom:3px solid #f1f1f1;
        border-left:3px solid #f1f1f1;
        border-right:3px solid #f1f1f1;
      }

      .usa-banner .usa-accordion-content{
        background-color:#ffffff;
        overflow:auto;
        padding:1.5rem 2rem;
      }

      .usa-banner .usa-accordion-content > *:first-child{
        margin-top:0;
      }

      .usa-banner .usa-accordion-content > *:last-child{
        margin-bottom:0;
      }

      .usa-banner .usa-accordion-content:not([aria-hidden]){
        position:absolute;
        left:-999em;
      }

      .usa-banner .usa-accordion-content[aria-hidden=true]{
        display:none;
      }

      @media screen and (min-width: 600px){
        .usa-banner .usa-width-one-half{
          float:left;
          display:block;
          margin-right:4.82916%;
          width:47.58542%;
        }
        .usa-banner .usa-width-one-half:last-child{
          margin-right:0;
        }
      }

      @media screen and (min-width: 1201px){
        .usa-banner .usa-width-one-half{
          float:left;
          display:block;
          margin-right:2.35765%;
          width:48.82117%;
        }
        .usa-banner .usa-width-one-half:last-child{
          margin-right:0;
        }
      }

      .usa-banner .usa-width-one-half:first-child > :first-child {
        margin-top:0;
      }

      @media screen and (min-width: 600px){
        .usa-banner .usa-width-one-half > :first-child {
          margin-top:0;
        }
      }

      .usa-banner .usa-width-one-half:last-child > :last-child {
        margin-bottom:0;
      }

      @media screen and (min-width: 600px){
        .usa-banner .usa-width-one-half > :last-child {
          margin-bottom:0;
        }
      }

      .usa-banner .usa-media_block-img{
        float:left;
        margin-right:1rem;
      }

      .usa-banner .usa-banner-icon{
        width:2.4rem;
      }

      .usa-banner .usa-media_block-body{
        overflow:hidden;
      }

      .usa-banner strong{
        font-weight:bold;
      }

      /* USWDS */
      .usa-list{
        margin-bottom:1em;
        margin-top:1em;
        line-height:1.5;
        padding-left:3ch;
      }
      .usa-list:last-child{
        margin-bottom:0;
      }

      .usa-list li{
        margin-bottom:0.25em;
        max-width:68ex;
      }
      .usa-list li:last-child{
        margin-bottom:0;
      }

      .usa-list--unstyled{
        margin-bottom:0;
        margin-top:0;
        list-style-type:none;
        padding-left:0;
      }
      .usa-list--unstyled > li{
        margin-bottom:0;
        max-width:unset;
      }

      .usa-prose .usa-list--unstyled{
        margin-bottom:0;
        margin-top:0;
        list-style-type:none;
        padding-left:0;
      }
      .usa-prose .usa-list--unstyled > li{
        margin-bottom:0;
        max-width:unset;
      }

      .margin-bottom-3 {
        margin-bottom:1.5rem;
      }
      .margin-bottom-6{
        margin-bottom:3rem;
      }
      @media (min-width: 480px) {
        .mobile\:margin-bottom-3 {
          margin-bottom:1.5rem;
        }
        .mobile\:margin-bottom-6 {
          margin-bottom:3rem;
        }
      }

      .usa-sr-only{
        position:absolute;
        left:-999em;
      }

      .grid-container{
        padding-left: 15px;
        padding-right: 15px;
        margin-left:auto;
        margin-right:auto;
        max-width:980px;
      }

      .grid-row{
        display:-webkit-box;
        display:-ms-flexbox;
        display:flex;
        -ms-flex-wrap:wrap;
            flex-wrap:wrap;
      }
      .display-block {
        display: block;
      }

      .display-inline {
        display: inline;
      }

      .display-flex{
        display:-webkit-box;
        display:-ms-flexbox;
        display:flex;
      }

      .flex-justify{
        -webkit-box-pack: justify;
        -ms-flex-pack: justify;
        justify-content: space-between;
      }

      .flex-fill{
        -webkit-box-flex:1;
            -ms-flex:1 0 0px;
                flex:1 0 0;
      }
      .flex-auto{
        -webkit-box-flex:0;
            -ms-flex:0 0 auto;
                flex:0 0 auto;
      }

      @media all and (min-width: 640px){
        .mobile\:display-block {
          display: block;
        }
        .mobile\:display-inline {
          display: inline;
        }
        .mobile\:display-flex{
          display:-webkit-box;
          display:-ms-flexbox;
          display:flex;
        }
      }

      @media all and (min-width: 992px){
        .tablet\:display-block {
          display: block;
        }
        .tablet\:display-inline {
          display: inline;
        }
        .tablet\:display-flex{
          display:-webkit-box;
          display:-ms-flexbox;
          display:flex;
        }
      }

      .usa-button{
        font-family: "Roboto", "Helvetica Neue", Arial, Tahoma;
        font-size:1.06rem;
        line-height:0.9;
        -moz-osx-font-smoothing:grayscale;
        -webkit-font-smoothing:antialiased;
        -webkit-appearance:none;
          -moz-appearance:none;
                appearance:none;
        background-color:#0071bc;
        border:0;
        border-radius:0.25rem;
        color:white;
        cursor:pointer;
        font-weight:bold;
        margin-right:0.5rem;
        padding:0.75rem 1.25rem;
        text-align:center;
        text-decoration:none;
        width:100%;
      }
      @media all and (min-width: 384px){
        .usa-button{
          width:auto;
        }
      }
      .usa-button:visited{
        color:white;
      }
      .usa-button:active, .usa-button.usa-button--active{
        background-color:#0071bc;
        color:white;
      }
      .usa-button:not([disabled]):focus, .usa-button:not([disabled]).usa-focus{
        outline-offset:0.25rem;
      }
      .usa-button:disabled{
        -moz-osx-font-smoothing:grayscale;
        -webkit-font-smoothing:antialiased;
        background-color:#c9c9c9;
        color:white;
        pointer-events:none;
      }
      .usa-button:disabled:hover, .usa-button:disabled.usa-button--hover, .usa-button:disabled:active, .usa-button:disabled.usa-button--active, .usa-button:disabled:focus, .usa-button:disabled.usa-focus{
        background-color:#c9c9c9;
        border:0;
        -webkit-box-shadow:none;
                box-shadow:none;
      }
      .usa-search{
        font-family: "Roboto", "Helvetica Neue", Arial, Tahoma;
        font-size:1.06rem;
        line-height:1.5;
        position:relative;
      }
      .usa-search::after{
        clear:both;
        content:"";
        display:block;
      }
      .usa-search[role=search], .usa-search[role=search] > div,
      .usa-search [role=search]{
        display:-webkit-box;
        display:-ms-flexbox;
        display:flex;
      }
      .usa-search [type=submit]{
        background-image: url("data:image/svg+xml,%3Csvg xmlns='http://www.w3.org/2000/svg' width='65' height='64' viewBox='0 0 65 64'%3E%3Ctitle%3Esearch%3C/title%3E%3Cpath fill='%23FFF' d='M62.672 55.618L49.48 42.426c3.18-4.59 4.77-9.706 4.77-15.347 0-3.666-.713-7.173-2.137-10.519-1.423-3.347-3.347-6.231-5.77-8.656-2.422-2.425-5.307-4.346-8.652-5.769A26.606 26.606 0 0 0 27.17 0a26.61 26.61 0 0 0-10.52 2.135c-3.347 1.423-6.231 3.346-8.654 5.769-2.423 2.424-4.346 5.309-5.769 8.655A26.6 26.6 0 0 0 .092 27.077c0 3.667.712 7.172 2.135 10.52 1.423 3.345 3.346 6.23 5.769 8.652 2.424 2.424 5.308 4.347 8.655 5.77a26.606 26.606 0 0 0 10.519 2.135c5.641 0 10.757-1.591 15.347-4.77l13.191 13.153c.923.974 2.076 1.462 3.462 1.462 1.333 0 2.487-.487 3.46-1.462.975-.974 1.462-2.128 1.462-3.461 0-1.358-.473-2.513-1.422-3.46l.002.002zM39.345 39.252c-3.372 3.372-7.429 5.057-12.173 5.057s-8.801-1.685-12.173-5.057c-3.373-3.372-5.058-7.43-5.058-12.174 0-4.743 1.686-8.8 5.058-12.172 3.371-3.372 7.43-5.058 12.173-5.058s8.8 1.686 12.173 5.058c3.372 3.371 5.059 7.43 5.059 12.173 0 4.744-1.687 8.803-5.059 12.175v-.002z'/%3E%3C/svg%3E"), -webkit-gradient(linear, left top, left bottom, from(transparent), to(transparent));
        background-image: url("data:image/svg+xml,%3Csvg xmlns='http://www.w3.org/2000/svg' width='65' height='64' viewBox='0 0 65 64'%3E%3Ctitle%3Esearch%3C/title%3E%3Cpath fill='%23FFF' d='M62.672 55.618L49.48 42.426c3.18-4.59 4.77-9.706 4.77-15.347 0-3.666-.713-7.173-2.137-10.519-1.423-3.347-3.347-6.231-5.77-8.656-2.422-2.425-5.307-4.346-8.652-5.769A26.606 26.606 0 0 0 27.17 0a26.61 26.61 0 0 0-10.52 2.135c-3.347 1.423-6.231 3.346-8.654 5.769-2.423 2.424-4.346 5.309-5.769 8.655A26.6 26.6 0 0 0 .092 27.077c0 3.667.712 7.172 2.135 10.52 1.423 3.345 3.346 6.23 5.769 8.652 2.424 2.424 5.308 4.347 8.655 5.77a26.606 26.606 0 0 0 10.519 2.135c5.641 0 10.757-1.591 15.347-4.77l13.191 13.153c.923.974 2.076 1.462 3.462 1.462 1.333 0 2.487-.487 3.46-1.462.975-.974 1.462-2.128 1.462-3.461 0-1.358-.473-2.513-1.422-3.46l.002.002zM39.345 39.252c-3.372 3.372-7.429 5.057-12.173 5.057s-8.801-1.685-12.173-5.057c-3.373-3.372-5.058-7.43-5.058-12.174 0-4.743 1.686-8.8 5.058-12.172 3.371-3.372 7.43-5.058 12.173-5.058s8.8 1.686 12.173 5.058c3.372 3.371 5.059 7.43 5.059 12.173 0 4.744-1.687 8.803-5.059 12.175v-.002z'/%3E%3C/svg%3E"), linear-gradient(transparent, transparent);
        background-repeat:no-repeat;
        background-position:center center;
        background-size:1rem;
        border-bottom-left-radius:0;
        border-top-left-radius:0;
        height:2rem;
        margin:0;
        padding:0;
        width:3rem;
      }
      @media all and (min-width: 480px){
        .usa-search [type=submit]{
          padding-left:1rem;
          padding-right:1rem;
          background-image:none;
          width:auto;
        }
      }

      input[type=search]{
        -webkit-box-sizing:border-box;
                box-sizing:border-box;
        -webkit-appearance:none;
          -moz-appearance:none;
                appearance:none;
      }

      [type=search],
      .usa-search__input{
        padding-bottom:0;
        padding-top:0;
        border-bottom-right-radius:0;
        border-right:none;
        border-top-right-radius:0;
        -webkit-box-sizing:border-box;
                box-sizing:border-box;
        float:left;
        font-size:1rem;
        height:2rem;
        margin:0;
      }

      .usa-search .usa-button__reset {
        background: white;
        display: none;
        margin: 0;
        padding: 0;
        width: 41px;
      }

      .usa-search .usa-button__reset:hover,
      .usa-search .usa-button__reset:active {
        background-color: white;
      }


      .usa-search__submit-text{
        position:absolute;
        left:-999em;
      }
      @media all and (min-width: 480px){
        .usa-search__submit-text{
          position:static;
        }
      }

      /* FONT FACE - Roboto */
      /* latin */
      @font-face {
        font-family: 'Roboto';
        font-weight: 400;
        font-style: normal;
        font-display: auto;
        src: local('Roboto'), local('Roboto-Regular'),
          url('data:application/font-woff2;charset=utf-8;base64,d09GMgABAAAAAD8UABIAAAAAkDgAAD6tAAEAAAAAAAAAAAAAAAAAAAAAAAAAAAAAP0ZGVE0cGkIbmjgchBYGYACEEghUCYM8EQwKgdo8gcJOC4NyAAE2AiQDh0AEIAWFFweGfAyCSRsdgRVsm1YzOA9AqOLmUDjhjoeNA48R3rWMDAQbByA9yMz+/5bcGANu0OoLVgkiKgibLUwmC7PZaAfW069bVrtCnvyhf96rUZyIA+vlhqnQlMFLNfy6PeLzw82/ZQZ17xOVFHmh0uVz6zaM3cYyTVxEzOhSZ2DbyJ/k5OX5qI7+OxGZWdXPA8hrkcu/GsE7AH2HaG73K0aPDYkcIFhkxhhjdA1GZMqkN4MoQQVEwCi0sdPv1VliW7bjTBxSlKyD8PcIu+37q7C6Cjvg1wOPFlP9zDlQaWmLeCiQFJ+v1jTg/l/ouMgYnbR6765EwqPq+DpVowh2OQRHOq0ZWTLMaK17IKi5vaseaLUr27lL2En0wIJpVnEnJUXzBEV7339HpWQH/tl/vPSPJLdG58IpVrEnkGMKQsFnvIfLtJE0amVrt2/PTq+IBcAA+oAFwCBoAA1gAHz/c7oiHJKjLfwc2BwenZS5/mcu4XE7Tr26Ih3GYNJp8h0bfK0TiNbGthI+F6n4bE1YGFlw6q4qbpyChsz//7XUzt07sxR8CcufslzhCiSnPXGNEosnmf2ZAs9uiSaIqsCkyq6SSVVG1piqyipr6lNr1qur6kmO0QG7OyFJqDPyhOp53ZOZdE+SCS1gaClZnOQIkhxk9+gjOlTgPicfiSSwkMhCSEYh1ff/X9WyfRcYcofUcKX/NxdVCkX3CWyQjrYMdlVST6Q+BqCCCThJG1KsPA9/AvExCaIj3dAhhDbHpnDTblHucdFWhv7d6dsBfsEDoBYGVguCgOIsxqYHTy0KsRk8MeenP7XvLJGx5tWcwEFm5uOny8Tp+vM3CwkrRves7U3BGwFC8oggIWu/J/tj+j29OevdbveHihMQAgED2J9CAXz3nRdFA8Bn/sR1GfVnlePfAASGA3AhwKXAwEEegzzxHMwL30EQgAYUGOA44HQgQIGkgQBHOQuEuNFNrJ2BwANTyAQg9VBySBRQfFRAPBHoQgD3n73f9KxHPphMBOggpRQCDOjNMm8CGu/ljf3NNOvUqd+cS66649CrGq0Jd2qulupWvWq2Pk/Ld2STuqQrgXdGScwQGqeH8bC80N+loPKqw6nuLKDluyQ8jJNRbx2pOvF7Ieq5BeKFFYImblqwdPDoxAOCCx6cRJa55z2vPATHnucM8kVA4kGKjQ9jmXeV4a/Iw4QH1n+fZFzJHv6gjptJHjDLa+YDLGAFJ7j4rnnO45TvmZd8oPLiKh8FKEQRKKonD/SiD/0YwKAazmsjGMUYzmIaM5jFHOjqQl65iEuYVwt5aSl2Na9dD489HLRCvLLY+NVeMO44FKcDknr2aeYprbyhk/s64SAY0Jy3CXbGdgcaIre4ZppX1hEP52TmpOLYGEq58+mCwI6bAa6O1scC4ABOsOF1bw4cWPK4936ObDOAZZlXXHOL+5zk/ywxZ2XmmuJ0Gsqi81mwnxsmD38GRTbvaHi0og3t6PgcZCc0vFAwWGHM6I5llpfMAQtYwSUZhTM8OyMCoxjDWayqNRjb2MEubuAmbk3JyixvmMMCVnDBMEYwijGcxer74SxxcqfICxcUp9SZBmYwiznQnw+xxA4Jk3zYAdexh4P4CchCA61oQzs6urOyhmcH2Pd2Sja3VBZ0Z3p3ZgRmMQf6fxHEHAIKKzY4kk446ZTT5MhTokyFKnWatOjQpceCJWt2HDhy4sqdJy8+/OTJV6BQEYoSVKXKlKtRp16DRk06jRg15qwp02bMmkO3YMmabTt23XDTLbD9XxDAut3WSwifZsEZjMuTPFVfp7cirxdrn2W/UfkqR03NpgjwvwL5EpJ43VbeJyvdgOMXQLn3eSBD8os+rtwP0MlR7pvhqdK42/x2tizvGw/rOeBMQof+eHDkF7mH+qqVtOyRfqRDfz449KeLjUK7F9GnAtTtEkf/KnF9n+dRjvIsE880t1h6gfz5PMmtMBa3053ZvEknLtis5XE+YAfIEa7IwOYq3x2kLU9Tg6935VwqMgc4HUxKs5K5/iTOSKWtfMEAjYzae9ObXpsU5d5iL5Z7m1T9gqtfY+YeXcnJ7Gof+RPpA97M9t70A99qzP8WbOB0J6WgKKTVE5OYrzhl9KOibYgefuRso96Y/lc9T6V7cE9JWjYP34YL4cPTwoldEQeVXTU8kuX1lGzpB2iNhXJn8zJGtr7Nfh7SDE5GUnDIlV6jCNeew21UuC+Peg8WfzdPMx2O5Cu5I3o7+ruqOdj10m/qUG/hxSq8MCIIK4IkBUZK+J0QLicFckqQZIWFnLCSFx5KAlEWburCTkNYaIoALeGjLRg6wkZXOJkIiqkwMZNjLATNWiPciIfgBIFzFiauguMpzLwFy0eY+cZyyEMBUxLLhaocUs3LIXWaQFp1YPHyhrPpMQhlGLHHjDgLbSoWYRod3IIwWxQmS8JsTfO6IY/XdWhBd+Tx2oMIOtCCzmkRL5zkIpfHjUtkeUAtwK1RkQdzRgiMrPBSEhgVgVHLckBYgIXMPEYcOclKTBI83wLESmgINsKJ8OBcIBA3YeORRUI4NzTRHjsSNA+QRGkYeL1hWrSAxWQmK5jiIER4HOMumIfU6NBDW3kLzKpA1npzuWYLD5zkIje5yE1ucJGPgJCGAQn4z52CIE0ZM3W6sEyY4TchCkE470zEbCgOibyv48LhxOgmMlp10hGFhjDP09l4INqJ29e72rbHzYFbfN4zzXvWP56mZsgS+q4KUva5spiufw8TPNC+oaNzKL2Jo0GN5a3trGtlb2PgKnews/Hu5GhVSRHRXAiDzFhw2oWwPx3/2Ac9JiYaSP0PPqOA9KMiwgKAavx63UfFBBGA8WMSosnAkoNWYID7fXmgiReBmODjKEww+OCdJE+dfuXaot67q30sdwWVk6DK4kFFGjGlUHhB6gqI0Gg0GBQOzzzh3jaegLFpnJ4ln4u9p5Z9khUvr8WB37pYrvUSxOMmbAwqPeKuu9W/9EGw11sAiyMvvfDKa2+89c57H65H82v5UboEiT757IuvvvkenPmYZ69KSGC9fikBdd5janxTaOO7DvfYU4GLAm4JOB/ATW9rZwb0gfzdwD/gIXtzAzzoLQDzGosGOB84cA+hgORxEZH9MobwAXA1eAh8gBMy/Yc25dQXeq3v9L3zwfBH8MfwZ8IL4EXw4ngpvBJeE2+Mj8ePiomLY//9//83/4HACXidpVCORFPOiOfDCy1cEa/xmY3MtzzNcqpDPmT5V3//8H9d3h5ePlw6XDxkHM4ezhxOHtIO+w47DxsOww8VHl54cA16BJ4CCBzqEQVwByBsXr0lEQAfiWL6uNT1wanrK5S/QcTEJY5LSp04eer0GWkZWTl5BUUlZRVVNXUNTS1tHV09fQNDI2MTUzNzC0sraxtbO3sHRydnF1c3dw9PL28fXz//gEBQRCkprW3q6O3pG+gfHB4dGTtLGz83MTUzPUufu3jh0jwpIO7BoZH7Kd2xhAdJUaD4DSAeeNhjAcCjnwSGPpwbHAMAj3nyQVBeYePK6rWt3RvbOwxL7v709h0APP6be6DgRfnl1Mqq6or6BlD3pvbW5fUNMgBfeAIAXEKbbCWS7Qlmy1MRf66UW9sFE8qtAM506A+4uwV+iGGd18A9y2AWDffG51j149oWcGw/hAI4zcphhWDimLlcEv4f7mEcWH5LDQaRvRjwo6EA7pWGBYpgVVGfC0IudePepRGdN3vY1VHNXqKDu0sEWvlCoI0VRPzUfhApa9g0nLblboTpiu28qjTTX3PQOH6r7nKPoY0PMbKTUmRhvpthjK+elHwuf+pcc7tkOCWe5fZk+sTGQBtCCbrdm4kUFLRu8l0hz/Mwe5kwJXNJBFZlTVB3Kw09Cj+md2os8T/HYzQCNAZszaG/kuYQaK0kkdLdYjHiJvUmt/JXPLRLfHoDf6mF/0jioxgw0veX9ooQMJIAcl2WkAHPu507BYzPyZJTxo00W8fa0GD570k7/nXa9SfAP4ETvwDO/AwARty/n9t0pYcBZCj7ddEhSHBQIeyowAScPRV6AaEJz+QL+8AWFFJgyvZnA3TtqREC+CA+WPxMOsR6KP4wLAd7dmTcRRZcVDdBt+emSSP0CMBdOJCbB2QYyR5s0V5Ha4ZWjlWQPHSuHa3/D1BzPuLT4F3ARTue59FpNBiCbE+Lc+Vla0zrJaLs9HuvWFR6csaZ1WFyIpo8WF37qE9VyMJpo1BJxMVEOydbq7q3OWpvPM55cskmG846k94l02HXot73MTaI75LWY4yjETHVGp112JxYWBOlD51JLAXXah30kydWzQGNqZVOFlu3uRWdRQRaHd5PgpR44xVih4g1Nle8a2Qwp8WxdLK0pnBZkBAkymX/cJiuRYeYjudUcl79N7/up/6ThGa8+cP/UahaCNUs1AM5GcVAfrrGnLpUbJaMlVhk6Ago7ko1gqN/bReHGghLBosINyIdUW4IcimqGeM7C7FZJaPIyxPU7RiBSfOGkXhWkbaDIDcUK/XuSp8OxGRapHq52ZS95/rLKF2yK8Fiw7/j16u4sHGriT467JJe5vNbp6farGKGlZ8b29mZbNnNKSfb8cZETxMjCkKPeiGqHk/MmCodZkdhJSMgOfWYhOVIqfYpLoIb62HdBbXH9cnaiEYb+B7fdIlTTuJA1SptudmJhBm5QLowTFKh46WUcP15NSQM5FFvjMK5Cp5eX49gnPQSW1ypZsNdu1OgGl4WoBZ1wzJbxMVue63+9gI1S3KVuIQ3SEdc/uvKVORTwK6T5dTRWW0HsKwWVJfx4Gi9QciH9q1GLKrYnr4DJQqwFT7rZT7EAnKcry4+K/aglXSAbluJfqVapTozp00iaqvitRa4E7jYhvX8VLf2b1T1Wvy7cpvPZxfx/zW+OMtbcKtum/06vcZYPUvhgj5V11iUFKN06CubWDRbCpxlQmnndLzt7aBRdBPTkqlWAGeMgHkZF2cxOP1Hl0NuArFyI2M/gktyA4y9SJp0o/4FvEw0uNgpCuu8od5J5K1eiLUABdfZ2I8CViYS4iHMXKkTbKY9u5/xxwVts65iKfjvEqznVF49FRMqhwIZIxt22o9ZjbwZzMLp6dSVYdNOI8o1gJuTiMTQ/sOkN/VWSzLpJGwWOtQSqA+APr0XmZLV3twWjAFoT9CICxIWJCHeJP12rS/XWzPgfvlp4eA94ZxKnsdWuBiRCRidvxyS8v4BHe5TeshZyrlPQcnbN8CNaDIrglDBEIqSwsyiihBZ7AmlfECFOWXQHt/wWdbXuhVzKqskFXsugT766dgGxEVCSzi+ejZvVlICEu9Ns2iNDVrAyHioYITWq3DJFHBBnZi+AgVK70a8M5dcFiDHNneGNm4fatQRLpkHhGxB1Xv6OqUEA/VvPVbxIWOXMzAtsGglWdUnhz4FAzgF3SdhRSOe2od9eNTU+/gjnnvEmJzIuf6k9+2cdw7IvCLxqm68RslZ4UQpBn0aNWT3EBytixHfADhJaIstR1x2ig+KrkeHr40HmrouOI4gJNf7YRhWX8jz35qS04wIKuzobOIxkE8hOAS1pgWE3BOoIgH7DhllwEPaNigpv3BPikA6M6WB06T/XIqeVs8YvNKItSXPqPOBMsYb4IMlI1YVNm1cKatEBxx0LThLu2OLHmNVikUX2XYUg6uhbs0HKTE3Can5t3dXHmkE1zUT0GNquBnxrc1yvMvY+rKeX8c0dhDpG5F/EouGkKdQVE0UCBnJ2lhYVQlMfRRCr5EUqdJR12wcSEQ7d5oUhOCW3OhP+pAnA+4PKGBxYKUWG+W0EjdlsNXmdMECIbS6d2tmeyGf78QrOufdPnEQesBJNIFx0Xed/XuyusDK/6OlevEq/j9ZnMFyVZN91ZupDgEyDQX1ohJ5Ct2KR8e2Ezes4wWsW/TXYRrf9GiwrlMiqdQA6Kun6jIbXt20kowx8ik48sZavCNHThxLSDQb47zg+Vs35Ikz6tBKuKnQXbHGSA+BjJ1nrd+RQQozcSt4JFFA9RLaelWs7w6C6n5SYYhKfBmbUqBxm4eYf4dTqbP2FdJ3F0PcwobNU8xoCaSakkvTcbIBFZlEML4aleoaW0tB4LYq18lTDquuRWfzPbs7j3d29d7ONgJNIyS6KZ4IJw9zl8QJ2nRR5bzDtMS7czPKDD2Sia9u6hSNYIG+aOnoF+wvTMu41A/aKY5zO/EFnMh4+ewNA8qL9Jz5lh4ESFZSGOCBzjrgfI5gWs4Pat2drc4f/JkVlxLchu9Difv6Z6xtmnCyk7JRJ49dSn9dyeNV3v8FV1/m5uljCQ7IJQ6S56ZXRcIc/xow9qO8KSNPj/fCR9WXZLx65VlW9fGtAmQ04YznFtWU5EYbjlCS8ba8XtU/Mgu9dpzKeKWhiZQdaT206Jnqp75xDi/7EqW7tIdzll3YofmeNRJLyGVgO926VG9d7EQwaaHYMnM6ktDUo4AnM/Zpbx9aTaj2j0sWeVlULze/drzm7//J7zlCixAT8BoDlQzkFMFSD0UEq3rkSFKzstqby4K20Z4V7lGkQdi/iUZ8nUYji/E+CPuRzZvKIs2PXLOJ2imMuxTgdLbBfEW4aB8xEBCGJuUd7j0+mykIdVu2Q9cRUOE/5QI977akxsdB7Stn+5SGGGWuC3Gs+56XNlBvgoo3Mq1/wP02/9XfnIHG82xwdHEZGzG6T35nPt6fjhWApK3AQ7wBkokr1yTxPWvSky445EOBfOCxns0DYO/YEludkwyBkO6ZSoiU53JJFg6JAW9L2YuOnfn/NKHtmio+x/e+mNk4AEYVduioGAiaVC5zlfrCOOBR8e9CpLJNHK0eo+gqlZwk7+yMRsU9/aWdrt5L1/txd+vuDfAwXl+bKyvoIydlpBJD85PlA4cT7dsihzavzWDna+fpmN3na3RqVV1hXl1GBKq2Ma9/KK+gd5hilt/fn5M71E8tRtm6BVuauQa4WNi6hNS6hDhKTMrl9Q+iBgaoZlIgmgcg7X4EmbsEuljauQZZmLkHOv/4FG4gHU8ON0gPLoyIH++N908wqDDrXz4/WL98tsDdvZboEGlrlGuU0zHwvxzY/vHAn2xhsGYctg89OrCsSYkJHGTqT81NbCyDSTzzT6hIcDSSU3DVNQpyt3b0IxZx7ldxx+SAB3WYfNvHyR3vnbJNJFOqYhhX0ELAObdU0Hko3k+SlG+RPPbaiVnV+GF84wePPHMpUlMC4wMki991C28VDrCTIuWZv3NJbGHm7rkp4yFTLxODdmti9j4ZLdOg6LnKkeZDF53kS/fEn3rCXj9ef5VxNfwJNMQQLBALN/PJhZcMTFeFBG7wsYm8bHiJrfCXryCPy8uOkcuEaOkdUiiZdpx+d7TJfa03Rw+V4YrfDe6rvX19XxqmMcf2Ou+gojxnH7p/8g3lkFqcfwP2ROs243o8ZZBrTVhTiVHwXS4m07ndhVxcFVfS2FpK34B9v33l9d65m1wnC/rv2vEFKVJzoboCMvifl1Ni6WN/ni5vHd1e8ks9F3EmSTJ3PGvl/6YZ3J9hxNUVZxaWUfOyWoqqIWqaesDRZsOmI8OxIfrk8sfVE5/XVzfdLK/dtth/NWJzpjRSl7J+hDp89Al2Z/HzPubCOCa9IjMxp3q8pbqdlp9irMwUrPz1XJv4Tfj/78UhOW/90mPWvUdf2Leuw/X/mlW7Djoirlf4dcSKuBhPdd1NySifrauvnHMwdDGXnDZfkqzj4268paS7ohxNHgqQi5XPP5908d/Dnd0/hxcSsy/GyvvLxQwR5l7fXFx4c5M5zi+1uelXfcOP6rK83JpyrmCB6MLC+Jh8ygP7XVNMDVZ6nK1h3Onkn8lICzmkVBOPrqRRbv0w5FUdsit0RBxvPfEU/vU510+f1lgJJ8uZticpqTWMprryBS8Mhikv9s+KklhatZJY6gqPTo+sYZehvmGn4QmFiZJa2CWVgNRqlYC0BZ7gJihRodjaKbfQyTc6IjoxIjQtyosOdT1em7m4u3luvGuIEGVu37igPXt/AjkRur6xfrzJO31eeUDFucTRsrzqBfYqR28y7FJNhEPWaTtdpVPY5zWx1IfISWy+aYPthtraZBLLV9bvFQSpheueU2cmjpMPripE/Ao7nOhnFWDF3p9Je/f+Z9DDsT79RyT2MvsGd21iiIQvWuZbun5C41uC9vX0QEramvgqbVB8n7Y6wf/++6DzEEDS7r19t7wQGtcadDoBT5nLXvn78KX6IJtOYXNJKpOIXpN4Zn0GIZlKqBByt8nZEngu8usdTDVWtfRKpRJz7/hLXhjP00W+sf6W+rkdzt9lb1d5JzqHKwUnzegeT8sliYF2FXDZZ0s+QaX6liF2FWzC5oNvuP8uP15i9yEtXVhXEuJ+WxtA0mrab+wlOWgv5QXlLQAkrbB97VOQoc3CvEUEOpw2geuvV4I2sywUI3ieHnspsr+gghdfXOMAIPv6ED9P6JIzN3NoxRDss8Fi14OuBYCkLZAfkBfDkn5fQWH5adoi0/Vfr6/f/nj/8kIGhZqbVF0HCuUEes/Nvak/zZ3C7ZfauVI9Ms/jI1on2uLS5RZPCRyjCa/0fsTPqLgaV5Dw05Ya4b1GrL8ahvDoKimzFxi4eOXtKvMlLGze2r566KBCl2mANso8WK0OXYvYrTJgGR4dZxms0N+/BMG3uc/P7HDDvkb93hWhM65wwP5ohWtoMnrT4H/P8XljD/30u2urR3NPZXFuT0s5LNjOHjt0o0A+2QV+JTdZ8bMZlz3VChrLkFxpfx5AV3kuTYexXzui8Shpd8na1YarHzOPv6EfHlCqN3IVXCLYtqqOTlQM1qQXdVY0AKkgF8o308OtxlHs4b36V3HZV1IW8wfqm8rb02M86lMjQ66mBvbEnMPtvaiHk0vXsxbzlxp7GrvSDurigy0SsHsAiZ0HSOyN9lA5yz7aA3ANIO9yir0XhKBHh5futI+d7eoZHWu/q1PyTwBxbldslTYsNk27rv54U3D+5CgW/qObq+bHiXGRZQ6Jp4s8x2jj2BVJHiIPERcvOc6DpC14nDTK9ZZ5fOX6wf2nIWphak9u3r96/VFU8F7anTuiQVWiC6Lhr8Z7CuqtBm3HKxWe5nK1fy8zxU+/nAcoynxjCmCaSzkOK6DRpFAyNByoz04FTHOpjYsARVk8IdB7/uKj0dMHWacORk5oZDfUNtQKCffe6YAkH0qc/M/skF0w2Xl1ijoEGEdTLgFx5NiggiAzhgO5fsUt8fwNBrznU52kG+ZLqVuLh7jZgyrndbe4gHRDGNePJ9IL12Iq0enDAAXoOjElJYen4HOIi1XXimfthvach6YKaq6F6uQG1SQxeYwjvBMGVoKI9xFSQLQ97uutotqZD7eZxsaZwssLI8qaNxckzjdtWPlK/nwtO3+JmKNMBygwjI4jFq1deKP0Yw4117BdSLNv++jYOEppuB5qjbuHw38S70r9c68858bRMbjNfXjHxEpJYJGdogHJrWgHG7dJaujmqhbhYCotaia8GBmpGIk5S784rH/IXPdSxTMgPJD8ouLFSIif5N+j04trRCo6aQi/++PjbsLDIE1XP2Ji9WhRfUOJDzFr4dIrBfqn2bqdonGH9nfOzcNFDdcLuZ1mU+tX3WC5V+hXQXx4TIxnkZ+kDZwOUIBu6ULXpK+LyEQTMjzTCFF63FOas+qCOgq135V19Q2dzmNFpIkqqtXpXlb0L3HJ6QSluwIT7YMe9S7vJ9xOcCl8JAjjejURSYnUzScOYyo2o36JwcjkffpmfAQ5I6wolSVsi7H65sWMYTMPXTMZN6WJLEpruczNf7Cazp5SHel/HxRX3Mco/GNvT/51SK2+h1H4Q0dP9d8uLeu7tz4xeK+0eOC2icFjru+PZBZXSenMdIC8M4ROIlE3lh9Loubgsy03KINOtUjHmpGC1l2Sr+T/o5OrC8RsJsIwQN6hI2KSGCsv5f/MMTFabxT0uVZh3cq7C9v2ok/F1dYrzOg3A7rmFCzds3JA9aKZvJioFcmRT6vXyTbOvuBwdnzu6cVahnV2dGBIrJuZUYQRt86Ii2OyW9WLs/TcdS9Srz8d4V1CIEdkOgfzJeijNis2OwxU9A3wafXmOJP0jLqSjtWKVVSAYnZUVOb1sanLYGWBfv7b5T2TNhxdk+b84RdmWe8in7FmGV++5kV1487/Cq5Fx01p1mPilDFw5Xpcr+Ycu9NpzuXTdf7fzr4vuRXAQxA/+Fn7s/YmQTyA58DpLQfn8pk1QeVHwez3xI3Z6nG+4VZiwSej+Y7Lblpq1Kc0eFEknfitm5TzTJOiaQoTTy+sf96r2vu0A82cPZxQlCTvGApsPul37/d4tgXDXjNQNGKvA6hLdTjsr019FPO9F1NOUw5HVwR2DCXJNIVzh2Bu9/1e1d7nzQtTj84qKNp+Zm5n3Co2z1IerLGQOG3rFOnbCXXOXqNaU/XGO38uWvvG+RkPjQyCPe4ltjprrXuDKFnkBtckM7mPIzNWL1fwH9FfTYitC96T2NsQouEf0x/W8czfQNbZ32OwecN5IZrpbrOO533Qim6zSVbIhfzQTPf62jrR8PUvby9fun/j3HxUZlpMRE5TBhqu15Zl/IHUnnd9uz2noCinsKQ0rGVzK6a7uj6nqLquLWl5pT25tiGPUt8U3X1lJaS9vCKvSBOWlka+sZzyeDmVtJvmvwJXkkmxy0nkGwZik/xK9fvEbWSGcZ9xurHhoqFuum6fbgYTcftWbDU7L4P3MuMbg8+savwi3dlY3qwoeBC+9pR0Wc1EvYR0jQ7lTta3Uvri/T3Kwnd0puXmid7NMYxpNwN506Lgfpb1By/hj67RMwaaqeWd5EATNbtCfRG7QTOSv0a2yLAHr6WAHdYy2MRUxS7fQNCBZoNzCjZxLyHko1y89jGQZtnYabn+X0HE5JNL02hne9uF3Rki7dJuS+dIT111kK+zl29UcVpsclSxr7e3U8i/vNGO49g+fa6+juOjw21i2P6uTlxvuwR5aJPhYbmWbbHG8NhcnXSz3FlbtdyadmuKWDjnYuWSnZSTFhbTnzRKUC5KN7FVUepkDRvJKS5oKi/UDuC390o943aCUU5yBO66Sr4xWo+SGOiCLj1Bj1sMg+Q1Dk6qsws32Co2OtKKxyU/gea/OJY5cDcN5makZemnKIAmHVckpuoGHc/pR4aPZ7WaQW4GqhY22sElY4rPeDorOvnRxxfCa1siw6ubIyKr68Ij6ur+HVO1MNXQtLBUVbO0JVhaKJyscSU0ENoH2nMactoGuLk/GzUamQ83uxHO8BNCTBT+aFuZWmm0kftr0E2ZxPDISCfb8coKV0xtqLOlmba8zJGphqXiqbbA7tT04pbkcDUTTwO+2pMVkUPplPy+jKh2GVstI1NzLaXYFsi9FLcGDlkl6ySOKWumgO7Qlvh1nQY8Q3MATfYuHK6xN99fwi6IQyHa+Tn678E+87/n7ABJO1N96x3J41juLLmcV3iyUaA6oINUgYq0c1WSk/4ZgBYtMHzX3OZxUz07MB5rwNQb1H5+qbnl/EK/ZQdjUfniYl83Mtg/1tnJlxxiG+Qf6+TgFw35G2IwGKsBEHEy0y9hdoElkDs6jhwdnE7yokOdh1dmV/YvT451nCWQDGyqF7QNyC8jrfwe3K/Lz8ubQAJxHP7KV/0fqyFps42TuAPbBvNj2EUXruTLIvfSmpEezvXmhYaFLC9z4smmP3834lzgB5LU4aM/EdwsT8jd3MLOzDYx1dzWPNCVRlRYlvZvn/q+7URHch38m8srnl+cD3fysC7wQU16aG9Z+z8KA5LU0Q/6ElAqYUQJIfbv40oq2LPPqOWKO8V66qV4czJ8WA92HiRNkrfmbnjiYuYS0/MnWA0GQNLoF8SPlXfUJ6d11BcBD2O6287WK8bUykRHRtamiZKl7/kKlyLrjs1zMw5TZ7xON3MWnlGJIvk4Klv4Xah2LXbwKNly9g2LdL8jGQXPw932kBtZNKnv8sinbOD8aEPb47H7D12iolPDI6jRDrPYio9T5+PGHRUcdW3HXCN2X4CjuFuo8bFLdbXJVu/0itqS9Uj15m0Wx94+jYeo0U42Ed4qcOW42mFMiYBofkH1JrwPHiWTYz+Ymnza4//crCgsupud/LCwJublVk5OT3Ks3FJp6e0a88D53DzPGXn19ncqZ0suZJsHofLYedlKzL2rui4NlPYvZ2c0Pppzlf8qhrvuz+ee+2loW2KMXAZ7M3zHnyWXO3lKdaT+OSypIPqcMq9JD7m61KTfnvb3IaUy3EXcojY9aPNq7Zzqkj/RdfqhecnA7ZCpGVei03i4IbX/Dj2E1x0akl31EWXqpKuS8pbQ5Q7ldWFoMoRJlcD+HDe5+28dlQMMq4yWYP7Wd6cP4UzfjPyaa0tC3DfTF4wNYS8ncBDGFp9CWxo3ll7V+0t1Jv+9QykvvhyvHaQfskwmbR/9fR2/hRrqWSm8kBRlkUHJ+1p0NUY3SCdwjVR4j0nu3xx6tuMmtbjjYGum81ZJUde+4c5BUF33sWIOgQxKXZN88DuWprqh2qEmtq+cJGXxhGy3tHgv79SE0dSUudQUSxc5QyMFeSODQENjBUUDk9NKz+4RUgu8T03664wKnWpXSENFJVN9JOL8NMREz6gbyehjnuMizLwzYdWUufhQ/3Ux5lqecDPvHFhF5WwuCPJfEysVCDf3zIRVJdKDQwI3REulw808KbBGOr2XELh7Ty9zLTJ6o/x3FNA9CDdijLdXLMFH0i062teHSHTnFZaESsuk8nBS+WUYjrjpSXUrlkNlUDmmOzrs0xw63v+ZcSpY4Wz40uT1vvgQMVxHknDyD6HjSNaJ9IniiYwJZqSQyOfIQhFcF0Gc2EvbRJ7PysguzqbqPBOjFitTKcWe/KSK8opyEr/nl/Way16Xax1yiboTVKMGIyGDQketz9s3t8Hytv6Hj5q31SykvAots/vr6yo7SqDMK9iaMxpZyn7eWp76sl7WG56bw5uWkwgEApxudwHHzZ3v9eI9vbVxkTSsLdKSrhCbFB4Z5Xu/4v6IBUOTUaCEDErDWV/ejdoNC3rLFzkRjM7Pngs5rQ2Qt+i+O+duldQIuUsEwfdBxYNfj4zKkWq6Jr0DI5tqN9AnsHYNYcRBeN8vye8Sq7YadzeMlVFbRkBHeU/zGLWsYQRqbUUtlBTAJyeXqPnwKXP0pjP5SRpvdzoqN2qobSgJGZKM7Eo7eijGahmTq1D1IN/n2JC+kGV2OSUlvaOyMKU/AxncwhyYY2BmaaxrY21pMRwsnieSx8UK8dwxsyYnFlYmxbc35VP7+xqUdu4/uYrIqFKyPsMp7uzorKdjY5tuauXQy/Bm9HtXr+ZGKZUYJiaqlmjmRXYk55IxHcmRhhb+vxJVE8PqEzIy6xMoq8o2Grp6lhrKKlYamVYa1PdqT+VlX5BeeH/L+Kp3I/2QxNLizJTujpzill5YzbVbS3H+WfV5AaltvqdMtZ1s7bS1rJyMDCxsfHA4DA7Dj8NIAew/ANcOsPk+4k53AmDzcMSdHgUwxwHmIuD2f/6dbge3yzj/zrABLqGHAcqdE8C/U5FAr/8yd7txfvHd4oM+/Q5e9wGwG/Ymdck4SHAVL4ZIQTWo10MRGP2KQrecQQpI7kwyLvlStSfVvH3dxqQNq6V5YZSfp9Xlsi8D44RxOpVWu/nOU53Gfpch7ElVYl9XWx5lhTJ24wzYk6jY16NfHhWSq2gif7tKSRPHUreUDnxE1eteJyEvSttUWlaCp10NgfVnSlXZk4phX7dSHuWLq8MihSadxvYBVCdV8A0bWH9MULbxCERG6sB2vrrsK1bXzMbUsyxkFbAsFjrvJIX1fboZMZZjuXMDxi/6j6Kkc6asu1wqvTS0K5odTQvc33WKkNuWE31NJ/2wTZo/1YPKozS6Htpctzzoanro+1FGg5WuD4eC9AlH3bl0AzujT3cT8PCHwPqr+qvaZwp9yIaLgO2DYOy5MrIT3TlevlN6YexUFwXYoht7briT0axkoIadcQevgX6DwRFea7223lhvrXfW+8CHnd9qPayfOh5+/I/bHf47uzel5wLwFODZ+VrR09ipwwflIt4XqmEEj0mSLdrs/b74fY0jeUxzAdbL1hh74IuIUb9f5wnV59y7qim+YvuNf6dK0qEx4tZaMQTMm+yG6M6UQ6CeBoO2uG+PSI5wE+zn7rMzcf6adbBfQGLeLOb9ajAvVLP9X2kD5vCuOmz7jROYH5ZG9B2MVxtA0Xpjrj538+J9aAx/M2354Ao+bwDx3ndkDaiHrv/gIdBXReT/Ni6F88++0VpRCoyfrze8cAdTeQMoWm9KV1EaMO5tIFFTPIdWcFoKCankJ0+ZDX17U2fZEFeJyNoYGj4V+vyGoy0jXfjiV+br3HJd2BTzV+o7J7YlNgCu0i19ftHYd1m3rbkYjTLGyxmQcPVH1gxNDn2wczp6dlh0VdeJIQ/NFpTJZC8wSjkAIwrqj3q2ABd3Q1EjrZ//F4AwVBuFik4tF49NSdWHpoi7Av0+yDOgxOBmtWEGC/sHKWz4+7/OLT/KxInma1/HIJop+W8BJIMRFFOBazukNF1Y+q0KPfp9TQXNT/hgQpmgu9qDV5oy8ZPsogVVQ2ItBbKUJ0pkZRuqE0DWFnbnwUC3NfZ071LRWeQ10ATHcZAeZiHpMzTT3eVzO2HhGJdB3rjb6gSszXDgYMkkpvtaA2ZmI3Mx28vkqNO0N2EZcOZ9Mknj1cHv5hJ/zTvogz6dZ3/ACDFi3EzRpq2w3X30mO79+pdms6lOu+44KxkX9eMuUnWr8n0wEhc5ALWNMywp49WWQbQsZ58OAJ7sIIEhvosrARCgZ9LcNJhywBSYomBcfhHRDLlNBvQSytUQJUCm0nRBRXUFZm7bwuwYyYEF7JsYYiany9ELeA23wo7gXw8EGWiKartFhBSZGmy07zkWoxKVxUTUpWnS2EVV/TQt+LZHh+5A0Ji+PwJ4+wgM/wrpfXGmX3OGeJAzv8IsAr25DFgVK9tDx9NInbG4zQ6YYreaeLNAQNqe53JAHpdyxTrEV9gRgATECoNqkRCRGy0bvCjBvkLxZMn8U0beKCekbW2xB0QDQT9pkVExzXMZpx8E5HPBSe39gCqorOwYLH36yQ8+oceTIZhicfSk4ro674xlT3Ws2YcE27Yo0oK9Zu0YsRz0ebuQk9vAm2wv0swoykXvxCw4cTbe0TpA8kOMey4mUCYZg6CgPzI4g2OmYA3W6WFrUjCkL1NINlvaIn+NECpTC/SgoOLl8GsRIZ42569XxE8K4I8xXrvlQbGDSe4zH3wPHkms46fVaY8ek8lLTl9vCMj2z+0QIQLRVaYBNVoDBsa1UKTd0Y1gasyYqyaEEJipnkgW1muBkN0sxS9iibmmmF3KLMTJi8b3MxwLU+Nbh/ALa6KtcWRNOAQJWgZHn2LmnmyutFYmWp9PMSIn7SSKZxP75TOch/p/TrBYtxr1o/79VDr1XfolAECOSg6A7D+uof81wR71vwj1/vF2Hv7oXz+j9K07fHQDJDg436PKZ88Nf5D1UrdhA6tA2X/ynbE0T5FSlcBTeA1fIYWfXNO+sHLuf3tONfjAlVASKeQhz/mIx4yKeXQPww5Yjp+0BDaA3XRhgSgkGxg2vkGukxWi54KDU1ZWYx4XtcRupiXfLbvU9OR8QhSWpdcpwJUjUJCMmM16molVc1ZazfukWh2ydgYVKM3SrpotfbaW1bXWPFSIn1tt9+ADfyRFJGUFcu/7awXrjcNk7NpiAoE1GBKmAyt9iUHPxfFlPb6v712pZAx6hJbARsoD7rTzLrWD9mpzYpHEUJaTFATEoWBWjRRIlT7YrYR2Dq09aVWIWVTyrs7HooF3uRl7q9t4IMdSJJi/8I4UvofwHD6CgeL/2xXzhFd8YZ8JcZ97pR1B9kvL2V7sBhqpNxoFJWnwJ9c24bCHoHL4j2BNClmO/k+IyyhH4U7rxGyWyuYxFkmkxk9ucpadw4JtNLysKBnxUkEoqHqlE9XOKyg/rmY79fgPElYjQzOziRICBNCl/Ylsw7Cw8atEDEt5TmguZPuOQUs31n5eTmBsQQE6K1FVy8ObfZ7qvbUp1O+CimrTgkp160Qk2IpQgWqCxGXEskQKeBMb1Q7rBVphIWz4KoFfMudnS7rs6TKi6G9DVUBZPsvEGyWg+pTeQ/RwHuL/rCA0qqRILEy9CgAvi72SbQGT8gEh82Zts9AGYb6GZzWjIi0hTe3L4QQ7lNYYZ4i2gO3YjlXD4egFMx37MYmZBoWwYv3zTGPavytT5RYtJKwUBDy2KoQwfFhZqqtquCjRqNk3fB7C9gkQwA4lbxrC3qpTv0wpBKe+U0dg0X2OYohvowKTDU8xEWpy0vipm8rcgqa9+vgvy+3olKPa+xaEDP+iJ7lQcR0SdumvnO9WhXKn/AtDNriXblpkvGEtM1Pa6ldmJetqE1AFNXM5LzjWln6r3KjB014pApBSM5eGTNjfjQu4oKLWSRq6qkXzdtx0kxe2zg0cbng6tYUGBSX6UgZUp/BaYdlM2RxKrqWGxYu2Qp3oUm4L6TBMjoZMRT4kNiJc4Utk72E4NxnrtNFYvRFzOoAcyA6pUKAopY2GNCH75CpL4kiTJEZZmmtfYnQJmpT83MsRKUxoOEDGgej6YnQ8Yr+IeKN+ilsmsOdg3ewS5GPewJShrUoM6+5EDLJCopbhG/dzHWpZWyyHnHbqTmklTZOCYkhkd9fHYVcuKwbVr/MAgNL7OVoSRoW+uls4N0H8YXEGZKnVWT5HhpaZK15lNsRlWahY60SBtTCLwUizxKfo2LTsmwANipkuK8p8WLmJX57NUaIswftNySFSaKjMsl3QNjkornfkV7p6OdDSca7vXKBfO2jwz7jifaiglbJUKBeMBnYo528PCyHeW9H9nB1w5fTQqB5PjIS+zYVSxMkfnKsp2LE1jICVlMUJNOVarpa1YoFDSZyyjCGklDj2kfJYw0P9C7jU83qj4+Jn4DLP1LsQGUd6XJDXaTFnsSb+0GFFe68cqtDlUWhJv5yH6aXx4cmnG+sW8pNzSWIkUotyVlGb2V5sjuKg8pjO27en0UlsI2y/n2w833k+ZngfvH+AXV/SyL/MiXrnE2hOx//IXANZG1Uh0znMlN+ZUh3Vg86/7j1xNRfQ8+ZpAL+zGk0QUvgiec55lmOrAkdUB9RMVjM9M6FqVdBXZPlk9ahly6PV4MuEQZBYtJ3Q7++/6P3E8i4sKod/Ls+geoqsnzEcvOYfnlihnSKk/WqYUfdJ3026mb5HHq5JMCvX6HBxl5HT1/HhmZXwgj8pCpLVb7SzIsZuZsjWAElBOfv5RRyoJWTko7ycdKrQrjwdVyLF0uXl8461q8AadVotRIR2AByF3hzWKvvVLacUVilFgexlZS/5RbSuxxxlCSzoHRuU/+HH35SlAjT8IdhfFIu4Cy2FUZiWU6tNueB3hgnLXBM3frd2Vc9TKKpIfYPS98z3BODl9GwlMJSvXk8OIZZ7OqTDUgfNyCxYYtVw6FfRvHSnHp8QEeqyB1lWqMME6vmAsqd36zZbeYMMY3+NU7hTUCBx3nPraQx48BeJhDeujGhEL0YVYsEusb7E5q3M0Mfx1yFJ0wOmlu2WZibtv9jCrZBOdJLGeFHCOYqPC2iKbk6tlPQgNspCucsNX0iXRsF4H770mnWiWyeYJMN8A785GlzYWpmdfM7gCWWOQpiTzZ48tBUZF9N5wMBV7kjeV/RQ7MeFdZKr5hVoQKf4rWABG4taXjNDuerAmEhinHrW/rV6RAJffKe/FU+PsLf3QKKKuDFMoDY5xuISAx94bKX7sXuMW+cwdD7oJT+I0dUFZ4Vy41G/Qp09KZIZI3sdZ0mTXzBCnBp3sxS9LO9mXbj0atVH9eTPdTQcbtBAyTOl0+mGMOYCA3MRy/4iD/LlKrXXzGjc/vFO+I+C4x7tr7y8e/0ykp3ncvyniLBMsj6YRJF78GhKtz/M2fZzW1edFNlLdapr2k8q2FG53eiL1xNHDuL+61tL5X5x3vu4H/skRsY9pZfzfeI3R58avC9E0Q5Rek609lNqGdPaKZZGCDk9c5na2dl75eA8FP/jFGmSm51iVqi/Un8+M3xeuf2/fEg3C2Tejq/vJ084rWK+yBMNoiT9WnCZLrkfu8ZIuj3Ec8sUxAgfxAgfxBpZkR0mWLU8LEjiahGMdxKDPxgHoa0KWfZLUKSzSf2xAi1XEhjgjMnvx84xMm6hI/e0N71QmQDvDs34gS1WqV2HJioCV+ymv3bq12yheutxONQeKT3EIFaOjWvduT/b1pkh2uO6G6ao86+phznMvaVFHBf78poZlayoPcQGTiN2kuSrd4WTM08lTtlkIH6zRkar7jrSv4osBiyBWT1v60Q4+5DlPgzBrHNRA98csFzCZ1eLzb3yTAn73rXj5MK72pdytxSWBam+iists1n2qvkcvAK0s0Uy82NltlmPXJlx/5BnnEM8zu6XODHZhQRyY5L7FfBiXcIzSI4U0fDRzXC31y3Cp+xmJqbwY3iAF0uWcyZGCmol3YWHCSKOb0mF0U7dcqmZbJo0HHUt+xwwgYn+dDzNA8dJYIAavDHB/RCmLckMwIhi0BCXDzeocL0ZLWhTNtyrKWPWP8cCh2hit5AmEGuWUIsND8rAfsguq7R1eBS1v95epw8/XThAWH9wDGtiBo8D05HFHS3XWeDGcetzWj7EerlEXFFRre2IG4FbMW2AkNaoo9cN7oPnj5pJ9yZkKZmZXma1fNpbRRZr2xPW0oQplGyG/QXfrJX2n7/YqocV0yqNkB2NmN+5AbfQWPs4uh3O0vZWWi7kidXEr0tLnS1aMMz2kkJzusqNaP0tRrCSOk2FSIkUvZNyiJ3ocs7+fKOYIUdjvBtq1Kgd/cPaXpEjd9gg3Lfvcde+w7Fz/IUzOJsroZtvdssg3P9hROToDLb2hmvnWjU3wgTphRlLlnI/cs3U5nm60m3Wq9bMiemavoAqolJlN/lliZXjpI1cf7UCSEgallMElilDZS9UkCzI14Vt22uTWl0p0RP5sLRNEh3/qFcH9z/xAJ6pclLoUiEjlE0G2SNqWrUlVJ1t2CYdq+5J7mJDrF/Tqf7F2kJFDK0A13aGWhIFiVWlIncPBoVgq1G1GlXPGms9vCGbpW5c9w/gBu6/m1fx31dcXLT6qyUx0uy36B3a8MzpwoMr1++z2a+aVCMjWlUuL2/IMmvaTPcp3Edvfoi7V5GobB46ooWiqXevfNmDOF2ZjGYdmzJdNIYcL9SPNYzMd8m+oE67/9+PDDcA+oJnaP980OjHqf13tOgB+Lcu1nf9P/9/2m8exGkcvG8ACtgfdcgGwMGVcz4z+02Q4c1+NUoFK+q/rf9qn9LZFSjzraSZibjuiZg/hVSIsL6goC+TGmRCs5htVRNuFZItqHJYw/YejwOG4QNfqKAZ+bABqcDrOrg+KKxzTk0u5jNY45RVONZZ7XIilzqh+dvQUpG09AzN0oEQzsOKk7qmDLWM2RlJZSE4YmttfwCkrWyJi23xxI2ebw3OefZzjcKSV7p4Ce38dBaCxtzCOb/EtUVVD3MnWxTzuBv90QrRj6MxPUXPDKVTnvfM4zd1+PQ67ZnBf4YrrY/K6ijzk0NZfdS6w1FnpNJZyUunpZRfT0PBn9c2zPPhKOOQ2AZ3Znx3amzgGeZ072n69dl4Erdi5dldja9f6vQXMft5rSkRUwln/VbNfMlzuAvZLHiNGjVjUegkyoJ/s+RPa1h5/5U7TQX0e4b+vOl2rrRJ0TyOGDWPmvotHpWpowfnZ0HousdlU2G/aYgZG4xtnhexPTWfsoFlgU6AlUP0RxuQo4795YMJuRCbxjwWyIYsYrB/SP9cQrV5Xopti2wJWZBF4+tX1vqrH5DtjvOTJhM5Ya9iNim8siELQGy2qltc5/VLy94lfDcWUE3kx4qhHpMy1qRNbqDeDsC6nu5NT2Vd+HNOoxoc7z3hfZd2L+72CSXLU21VQRWKdiiCvzE9Rg+tfk91ZvJbkLBZbRDg4Mq8CwDzMUQnlfa294IsPA9S2dOlyosrTXYs4qzgpCHAv5hAMoCo2uQk6eovgVP96axV+drL8t9MKyjt0xqT6WkDyhVl9jmctuCKs2PDUdePpup09QerzSOA+wA0DcKmchoMh75pcGwuKog+u9OQpLyYhiJUEpeVg3PZMxKDJAVZhDDh4uEpkqfwnoRnJoZyIwhCZrVAFETWbZAoBJ+jhozbeW4h4oQgSxQimCxQzzVcxPPnk26wIAbJ+pVL8964P8W+KwB3ECPQK/ESeCEYjAGhnlSYBAQByMATPuS/cn2OyLvEqTJOBCTx9hTZDiVqtG62Vg14PAiboqyCkpqWuT2ohdajjBk8dK9MfGAH1axMokmOnKRRi6wAJHPBg4QLISsGWRg5BBGChCBajOKM5VizYMSELScmZOJYKw/4bAAX7WkBpICg8BDn65rT83Cc3L+f2ySjKCtfE9mhBmXBhif3L6C6Rk3wBxC4h6ExY8GKDTsOnDC4YOFwO4YHLz78BAgSIkyEKDwx4iQcJ0nKgfDKZ0iTIUvOkj5FZ8JuNSM1Gh7txlXXZ8CQEWMmTJkxZ8GSFWs2bNmxdzb8J4IzF67cuPPgyYs3H778+AsopB75ClxU76VC5ajaDOktlBJ35KkppjpQpgHFsgfFrN2wr774ptuYDevOChSkUrArQly2adtV12w5EuqGHdeNC/NBlQN79oV77a1ikSJEiUZA1ClGLBKyOAniJUrySrJUKdJkSDenS5ZM2XK88Q7DTTTnisUt990u1jpeJ0yYNGPWiinTVhVx/wjEAXGCS2AeXIAwEBcoBe8hLISDuKFjEA/EC/FB/JAAJAgJQcKQCCQK4SExSBySgI5DkpAUdAI6CZ1iSiBGyL8WR4URUkjhitum8WKIgbzWCRsqoo+SU2OkoqER/D3o1UcjZIjyJ8BEOdXnJ6rUlBHeW2IrbmpiakqUwsZsrxOydRNG0KF+EcuIiLAAJ4GwuA4Ji6uRRMcnxcg6OYyjY4ghKsGcGkLelyyu/HkDdfxrq1BEYjuBjotI5jCPBviaPaAA7+yYGCGGuhJ5GFhxAABrc/AeB8CB9mnS2M7QwBkwAWFgZ6AJLiich1kuTXlJQQxAnwGzkLmWrBi3TJuFuZurn6T7gjsaKUvyCOFro32GX0hVaXF+TqFifUwVBcVUleStKSF0Zpi9hoCYnU1UpbjFkuhvpSp8WfOCbTliuz1REqQtdm4MGzNKHNqKJ4S4xKmvfEqYe2PsDQz6wASWlekMDbhWeyf0BKC4Cb8pWZGr+Ak7YqhgnP8RrYQJPfzImpwi0LkO3ke04if8qGCb/9FrGDE4cngobl14KA4=') format('woff2');
          unicode-range: U+0000-00FF, U+0131, U+0152-0153, U+02BB-02BC, U+02C6, U+02DA, U+02DC, U+2000-206F, U+2074, U+20AC, U+2122, U+2191, U+2193, U+2212, U+2215, U+FEFF, U+FFFD;
      }

      @font-face {
        font-family: 'Roboto';
        font-weight: bold;
        font-style: normal;
        font-display: auto;
        src: local('Roboto Bold'), local('Roboto-Bold'),
          url('data:application/font-woff2;charset=utf-8;base64,d09GMgABAAAAAD50ABEAAAAAjZwAAD4SAAEAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGjobmk4cg0oGYACCBAhICYM8EQwKgdhcgcALC4NyAAE2AiQDh1QEIAWEageGfAyCKRstfgfYNo0G2u1AhCddVj4KgY2DDcR7zMhALRV0/2X//58S6Bg7aDtYmMgIJLaKxkKneetD84Vb4Ra6Luoeq1pO+Jy0PLHURYbIWPkSu0CNxcLM6hFZ85jRaSM0ZHWTX+T3P6rQmnRU6V1/deMv537KIQ5pseeGIZiDN/2wZlKz7SU7od0ivr8gMCpDd3DyO/WQOTvhLtWm3vbuOwPbRv4kJy8Pkd1Tr6qrZ3b3REQiosusFFIohWZ0lxF/hufn1vvbiB4MAckNtBGBMWJUbCNqDMYY2SNKEJEYmYKSOdoipUSPFoxEoQ3Mu7MO5/J+hMJWTT0B2wJeIUmBrNz/6urfK7LQkizjmGc8u/xHD2g3xFV+FcCiyTnIRbc/9cc+2HOPLgMTKDruEPqvZXv9/8xelvhLAbIwYykk2SUjsCu3kApFrVLUyFPgghs/3asOYIGRLuOsYCs82P6Z6y5rtoVlY6PKDL3Pfjjo1NwmzULFKpkjQoj2MkmkJY5IDoTk8u8TcPpnTHYM1sacYijZUJMl/+c/XevPRgZfapQG8BOYWPU70mnNSJadzO5a9j93gFR+9d3uynSRKXESH7BhGinXSU7RPEELWFRIkuGAH/4//ZnSlwH42wsM1RZNgIo2qdMW953ReAno7zXeCUaT8VLFIhCDUl9awYxnQsm1Sh3kTP8c0OHh4YF0kAPV+/s1K7VV//dPDy79XVZELsIdoENhrs6dUL9f/2y6/++eZLonU+memapMspTJcGYxs0Q5ZkeggJIs5gjRAqozYtWxEO5q1dYpFNKdMOf/v6pZ+y4pUpGH879z56r8pGacK7troEdwHgWQ1AwgTQqkU5THIe3qf4h7iA/pnAEcQiqacZcqb+ey29Bt06/Zfn5siEEcmTfWEhGvtN+zXKkecCu4FUSQtcarE0LrltL+kPRluNK9/9vOa0CxoAHKyY59F68nfJ3dMi1H1X4Bhl/7o64OBg6yCfLWNpgdP0AgMMD8gIVBgACJBwHmUaQDsdMu2yuIn/ji2SB+6rNqgfhZh4CAOATAY8u5M0/2CHAC1hyCMZW46+J+Je29dguFYhQjVMKkNba+Nt/Gwzz5c/E2n+J5IvFpniGZ1JayKCuKO59tyCZSyOqkSDNq9iXZIt3TrNaIZF8bL59PLBV3PawDkhgJ2WL84yBECOx48EI56bQzzjrnIkVYKnBUqcPTpE2HLhJT5qzYsEVmj4rGiTNXKVKlYUqXIUu2HLnyFCtVplyFa8yAWh06dek2YNCQYTfdMm7SjEVLVqza8BhEvSkIeMI0naJNRC0REFScFCH3gZB92cn0KKRInTDjXiJ0gGiQmCGjRNu3zbF9tHY5m1RKelKlYUqXkWropUZNmrVoTbV3oEOnLt0GDRl2063U3faNGDWWGm/XZJim9fI+WIP1DcSpidZrH4Kh4pc5jo16r+B7R7ND2r1Qi4BQLIT3B0tvu4QToin2jXFqWUhBEguRmaG2Ot2pDgIfYfoEEzab3KFAAK+DPn/FJ7ewU+gDjcZ1N1SrKRbFDomnxbMthNAuIpCYodR5Q/sQOkinLt2mUzOQFi1ZsWrD42jIUhV4EDpENEjMULTr0KlLt+nnEUwJo1LmRJBxmwO5TYMwZNhNt6KWiGGDLJWQsWzNej1Zhw4dOnRYxe+Ak6sHtY+cegWOr236fdXpIxjTPnBqHySzV/hxt4mPMP4W6RNi2j77HqO2zx1KSN0S+0dmtdqacKdxj1pNuj8+iGUoiDLFB4VQBSIhMVuTY6CEkw6JccKjfQkdpFOX7tRgDEOG3XQrTGt9iPx32NmBAM4/VydJDDDxj0xve6dSb8sO+quOHq2T++11me4aZU9Lfe0bShf6WEYBw2sQMhpPHu/nHx+th5/Qb63yZswiJxbLtt7P3T62Lq9twJcp/5Fz9D9S830LAmGP7pHK/8XJ/3lvmGnNLPLV3EtHODPrntzQ7d6k2moPR/cxidKB9Fhve9zduycFNNFhtQQJNdNmn6h++T2CHSeUX7VALb0rTcXkchlR6wY8kA00JQS21U9gU9mnzpxzPl9XwJUmt5X/Hl8K65qq3KHKA+yzN2fnziv46L/lPkaHEq752pTPm2e+SaipPCcW+Vowv+Dwln3jj/in5zULGhRx3a/WQdjj1yC68RpKazfs9lC/10ANsZT7Yjrd6ppGZbQwuMYD9YyLDfOs3veoV8h/a6owPLUGA9fpUd332LtLuSZLeqV3DZZH51u4ebZEnuvYzLMznT6I4RN2UGA+CkFSGKHycCedhSBPBRd1OseexgiOI4FKMg+WYsOONHsqi/ZsyqFzcUKKDKdlueaC62ppa9DKQLtuRANusXiF5JHN4NbtLVrjYN1jzmDU4yGiRJRIYAkGCnOKHneaCjpDIWcpGwXK7SLloUhFYClEhQpTp3w0KDc8FadJxWhRJG3KS4cKMKbsTCgHgjiWbi1OjEjbQiCDwtlRDvYUhUa50KkQZ8rFRfLLgGEMwYKy5WFTXA5S6hrIdTW41RrJKw9mZwg+pkM3TgPBCINugRunXCYoh0nKZYYFumiJLluG15qeqDWiEtalxCvPiKicRJAIesIEiYoQosJOSnZ4MOdBYRSoKCyFwVEYNcEvYS1uwkWOERQRIDwECeKlSSBmJCHZCJwgPDgKKMSB8nIUbBIeECfh9PgwIEWEJOwSJl42TJUqME24CA/mYCAQgTNMumsMm+SEx2mqojDTFDKTLegfC0TkJIJEmAgSYSJsC76TOmwJHlaeU1o5bCQhtj9ixsHvOL52Q3cZj1rPHTTeLDqFVBMM20DtNqJFyoTj3hS1FEId+DvFE2XInoW6CPX51vtnUdmG6S90POwD0+oyQAN/N9QEJFcEaAJunx0HpBOIwjGxrLzXk5z+FUVBIA8gXKkHDPuq/LbAmbLwFozF/j1Kkm1q7Z20ZtrUlJ3MjURhN+E0SQjEJw10sAo/ywDf+0S0Afc908Jtz64d+w4ceu+DjzrcxOLP9ZEEUaJ99sVX33z3AwxEmBSg1YZ5FxvQb+1YIFZazm7v8XmzO8u8RhcDawH2BKwMsOu+hwWggen/CvwBThkrE6BBdwHUtp0FWBn8cF3LxdMCUIRP3tbQDou9WgtI9DdKQc67OZNP8/nKiZ6Lng+9+NzO47ybT+eH8+38dj6XH1+nu/C/v3//L38Jomi1e2U7abG5mftDfjDf/GwS0x/lXblXiqbwffzh9/d/3/9l7vXk64nXt/NwHsr9mZWbcm0uz36Ps2/ufv0DvfEOxOyC1rWn0R+W3EJJp2lrElwALD5zI5xV0A2Dp7YlXLmQnUV4EHMsmgkO4/iHb8AAnia/J3rWh/0D3Xh4xt8rTrZ8Ke15uHXgkDk8evDkYIdgax38kBP4IhlLVTmO4+U5jhN+OJwRFlo7LXKJjzWGruWxXPRGLJLSpvdFte4QjkECu8koxk8HkyeNp/t3ioedJ+/LoYwEtSckr2QtB7RHQTslq+pQxacNzR+PhUhRJ1pt2eoGGxMxEs/WY3y3ElWLWuZRnOlgL9ozzVBjTykBXwTn1s97jboVpFlgLqpUF/AOvcPORIJfVVmd3z/ENFg0wLMXbXiYrnLNHK/lnkzpNeuqAXLXFL5nSphNBOO/j7xxIcHE6BDpZHE2NElnxohUNDOmoj/idHRlpdd4yr/gPvBg/xh9gg6sDN8Da0AXKYqQNj7yKMrFxrbEJpyfUVccxsitDDTsaIHJXNahmikQ8hEHpx/zaF6M3rFiZJ1hZbucuOUvi9bhPLSL9wXcciF7BiVUdgXiCo3i28jOjpwh2yyroHSrf3tSzVhPDza1hg5SsxCcUdTQ1PL2QtO5TnltdJVySvlGPTGCOCEGo4zaGpqliVOZNbK0Tp6LjKdGKkHFzUc4aW8GpypR9jqjOlUpHYM1XjltT8v22y1TG9pUVO7m3teUHozSnXW9SpytJNXK0OaE5lpZntqN9MRb00hpxeWlFoOhxpRCeEUbMxohjdI1y+w7hNMlFZRuKKUVrc/oecOtPtG0LxTPlShVZr/qj3l7d23Y8nftBDgsD2iqximFKKOExZxr5InOLHqCslSTUDWHiZqoBYrSxiZJHDNjYHrZAAXkOciYUUIgygFcrRoIIccMtUuIlPMd1rkUWLAjMowbEDvnnWyuEanG8w9aNs2XDCaA9qKR1vWFKfaAkTax16uX4q172GVNIxj8xWnpwr9UYazPBSYTDuytjJ6rs3YUiaW2C93EM8oGuVwZ7gadhqj1TLuuGzXLypEVcpEy6lFQKEdn5EQZ/YAxF627IRa8J4pc1XDP6H1Z7zJ0taPg7QRVud7GI+LGCg4WXDUkQ2Pjuu9LnnSb8gSo5lym5HV39zF2FAsgR7ply2qsvEfCsArlWiqWwEXn3KqcErqGzgMMlBHdtvWfi7G+FrQS8gREfZbjseQy3sjMjBmvrFk5Foh3rNv4xzjKGTco5L/QysDe9bbGN65FvvFp7FB0eMiZIjtcwWqhWWJ02J3A2B2ka38CNBOR0hvaR+/on+oL3RLGmaBOWFm8YKHjKfhmK4OwyLmfTB5LvfyqVSHzO6HZ62zznL6G5udqvNtpfmfoQuWaZDWRp9WGGDba12RS7zpK4ibUFfrpQ5x95AwQFlJfI+cmC4D2tu7pcwUQLXNnWlyD/kty2fGhwlUY2BIryBuRWck9a6kceP+ZwCjx0pFexx6q4HtKDczJojnClvVH2tnVOxiokxPZI+8rnijQww3HND1wkWQ5Lap0oZLiSLBiHFuBrwUga1iQ7KfKurJ75TEr0y+tNrr7/RhnRNccqjk7IKdOBAHdfNXOTb3KU53xTngxfb4Hck2uS7yRi9FHJj9bUkWim4lLJ1iN5VRxA/c7mLDggdrekVt9Odw9RcN4QXrc1vPhBnTFLGCaCIBITuxooNwT4hoNxQ5NKlhl2lL+ZzUHAVfNJyJqvpNDOEw5jyMl4LaIxqWDNLQQCNKR2QGOXeoXo9Cossgw/28MGQ5DPIy1T0FPTZKKq3qmNN2IMUxEKDUlH8r5pls1GZkmRCucM1EiFMETh/o77mNIABXpNAdqLUxdG9xIjKJIh2gu4YW7Hxakxx/Yuk3JdbVFJxQaYg1vVkD4g5uashExcuA6uNjU35HOJQxrfcgsSvaBn1RBrvNWZMJrMtTbEl9jos/s536bcDpyOAIOO3tlQvJcQEykqxvob/1IUX+INk6wa69CsUo2sEzihBeSO474n54xnUs2IaNZ5BEK90jreOupQmTgfvaaPBH6kYYEbbQIEw+EYtSsadSgTT4BTubZlD8d+NMtVnAosQrHrtoYOyjF7uKYzOdL6dyA3GwSCxPaSTw30SpsvxnIBSSgZZvFgwsXrPC6VtpCMZEMOWifuw/Pa0K5BC97KyNAcmQi4NaGeNNFLaGwekgaBcxtXNsA0Rh3utUYhM5rDO40YgeGgGuW5YZqW4AEBUWpPCqUKHZVvaSKJekp/jsQkXNnL+wZUFzFciAMOLkS+MYVJw/HsDT4AEpyaTY2rsa4ZcbQbpsQVtwu9mJ1lZLHck9e2X+fm+JJCJdaRm+VAhOLlYCbD04Eu/4beBgpIxAxuWWshsM2ZZqZww6VVIFf6hca0duB3vNIy0rVxxKX0Z9D6DeysymakCTB0CjkuCJZZEZlHPyXd8ZdgOKo4pKdGKesYqNDp4stxDm6L4GIVZ+4sOb+12CzYKj3vX9vANRXkxAyfYjbu2OsY1PRlghG5GnsCZ9nv5LhhUQLxuhEZDBI4UFcY3Ec/LWqG/hWhisNWcsyJeoKZN2fqg0RGBt5pckLyckU1KaSzcFWsDkw/U291S8T4FiIhP0KT0hkrHEEh5ZMHYrRtiiz2RF5jmwjR/ImMSZzrZLrQDEfjtfYS4Fb6SVBV2IMmCRodWjsdGNm7QuYSsBIya9Zb71ufDdnvEzHjFdhwbFATyhyHgssN/N8o9YM5EqRb8Abj9ddGxf+8fTFVWOvkMLJJILDiqCtE6PWpxgTxrK9KkCSbeJKVhwtV096ZofPueMUl+o5YLEGhcAf8mW4GVbsmoGsJhwIFtQPoqtnNd2SS9T5u/l3fqlYf5l/63UuG0RhB5dtLc3uyPrvAXRWYWRI1jb+lRzWaWuqrW5Cn5qNwLJhmaOSzuxnS1MPQrH4K2/MD48oUCBBcY0aDnmi3hQF2iKHXELFuXbhyXg6iSeduWtCi4/vjK7FdUbAEIiWAJo2vOiRReOcXQtfq+GliGw/88FE5sn8auT1lCVZZLmuunECm/Lj0fGj3PLDUJ7Qjm3xzLR3QnO0YzxIAg/yhAACQmkHoi/wtmZTgdS/2dO3IqeAb31uYkgyfR+eLFNL2hC5xjWMt2ko0R8xgOQMGBGtxRI36j/EPTf+MLaStrBt+xGmfGHTFqo+tdED3/O+WLibLfBK1T0fQoyjP/LEvK2DQ84ZkDPcumT0E0zuSIWrMZ9EpRgaNFUkYrlUqr0Wsin6dGX9yXmjzFPeuC/zr00Qrg1LobedkJLEbjcHsWbIoEk0HH/W/f/ee935JxanGU/IbvVktZL7FVua2xObG9YMP51cj7aNjT7B9donLLHZr/cwsR7RZFtHuq25g9MH12t2/gFqGU7tq6u3hGZrZh4ee/39H0wMIzGA6k0PZ/tawexqzs3vaswlpnc15OZ1N+aMsWkZERn6JB1TLX0SXs2QqC+TcjG9pzEnr7s+n8jsaMwv6GrKHIOrESxUL6WbaxkSGYZEXehrjpl8ZHiOWbpJujejo8xPz55UQW5fXxtqWJoo7O5JDbX+Xw4fkfNdMrnnyS+iKaXWf/kxfHMP4UfXkDazpJr5OoQEQagoM4cwc+UmeYIXiYTXMbWKFMQFSxYPn14TjbfairvxXidLW62qMLDhnoLMxbrp4lC1inStfZX4YvgzpJv65tW6L7pZmmoVuQENIzAM7nz9bGFY+BMa/wmXWgV7jjxGntSg4gdUE1D0KZSnwiX8kC51mauaMSjXf7w6EH3e86I/m38FqiKALSAdJXErqMxSTs8gDop9/RXMgpDgNzK1/2P3sEKXc43pFBMCnWJs5GRHJDjZyd1P2MAwL2ygDMNpCv/pHn34qQE7wav0S/P5T3XYCfTxQY9Gfx+367Bmjz63zsAA5yaonYjB0KgBB7QNGTxpe2b9m5s//QbB3T3EyYPBDJFNS3y2k1D85t+N6aDQV+klpvRwJ7FiamWIf7AT1c+dTg6lkTDhlwaee6ftsD2f9Ipr8ZC/dD62J3ZSfG/vqfDWCMb2ki/NNzKI9vTTtULN+hNNe02aGE0K7+DJL2MnTmFzDGBo09wH5LeKR4Zy6j6qkUsH0G5u9MsXl8pT3wQkT8DjpTlpQV5UD/+cqwlxKQzfb7eC1XBjHyTvwT5Mi/ZERPWOvhJ4mXdp6/WVvG1xXR6/930BljPPwd5jkzBiB7UwrN7XObwoKiai0MXoGL8cjl9JzmhmbR+B1U+9EODfQFf0V47vi5vkeD3D9WYiLr7fT4mu6NcQcPvH80dr/z5FYo1dg8Oc6cEMN+fAMDeXgGCpZxRHH1sbR0+qg6N/I9U/STHchBFSPrHD+SY/4cOr1JyCV/nxfKArMMi/xozPBBx9SpB1oyZehKKY4tA6F4fQ6tiYoAo3dnaqv8acGG45+LAJFhPR89hPPEy8UeD03SCjeRHVsOAD8wqEiIrQRnMMmwZqNb3U266bUmmQlSw0+nljZW3v4R2KWZmLk7W5GZHbXUtS2ZBmn0ezD2ijiP8AuQXbinH//R3es08gyRh5ZtcV1XxD3RdsTAazmZH5Xvr7yvpclqpkLXr8OlsXko6Pxk1cuNflx70r4K6ZrEkePKEvffLa7IKiP2fE2lA1jwwP6u1gxocfP3G9P1/3agR3imGGuZIDRdL67OOgsxGJ9xI1r8rze57XxWyxRGSPsXQx0kFDaEIyYGP94RKcnwoMrnc/GSqR1Ba/wrPxA+KKy4QCor0c5xZgQqsvN+G9nuH2CStlVoVbyH11PiCmF0tyXCnWFWof+oXlE/0iz53DTMwqK1mH3oQc5j2pzM5I5Eol/JSPjyt0tuk8MHzQrHmxaxRwRY48LGTd2oIeWbwcfterqbMZo8dsPFoCbKyFL/VOetRdK1mPLC+JgS8ZsdMraI2+ae12OmBgRLKxUgNa9XxapCPcehsu91384AQqISMi9lrNFth03uraa20jEH4KvtCOsFUEjzBIjPHZ8pYkS3mLicdHKyX/iCX/KfvS2quI3B1of0Mh0NHb3d47KliRRKhqqW2/ByUpA+EvwxBMjOFZb/OuT5eP2rY8orPoJpaoF1rUCJ0F2FgX8qS6xUq0F8RStaS68obkOtqiwSMnUkZHx7+SJ4rHx8+b224Ob5QbivcMD0p0VRmAZeJGpYl4d5B4d6XJ+kXwf8P7ivKGfbBJeNXwrbK87hBsErsANHbnjXrjvzFpz3PXT3yHs3/mjUkI9Qu8nBICoaxsJ4cfpshH0o5GRltx/xI1iCavC388dv07JgUT3VopTZpJxuNt+Q3QcM7PYfHh3r6RUXFHnmo2iZQYmpoXTfFH2tvo1Jv/+lZd/8Jg/pMi73U5JDwkjm5OyHPNOvvXfO9t+4jU+udW1KWCR7kXjtCBMfY+5o0joyPyIze/1F+0YGONfTx3DP63rmAH8/IT+RnJcb/hXPe1q/yEGwmWMoMsDZlSloW6FdTIa8R7XhjHUuBfXahNhfkunue14xZAcP9xO9N/G/nNsWW574Wz6O/CcB7YUsaRfDoFrZBPlHpbi1RCls8mSWns08sjCusCgm/xi1GniWzaWB5gx+a9YgGOI9YJ4LFOn2K/cAYF5tVr9a/yI4XyT0si6rvmts+tr9Tdtk5rgKv5/NeQuJzd/HsUTlNkUzXTL7K1Zmk4p/PP8CeQpmNm7kgm2RprY1wialZpqXP7c0OPwLWzloJCc3qB6jW3g57wlQJVM+M4w00U4oXsLMuPyRuOAOwAc9ozsmHmtSwnGtHoW+abhWV0qIRl55zPFNb3UVyz9nSAiAIgOGrooVfCLs8pBOp/rrO7D75uQ2MCENnTz9bbp6hJusW70EL/xO/N89PVPlFnZEERsPGFBzLbx7bl0d8r/Ou8maqMDhwjbdnTDfXhnNwXyYbLYDur5OUfUSi6l88/50pQi3NsbrWe0wsf7pRY+4AI/sAiUcjV0y961KdurY4+tDR3V8seBXulrtJwzWFjbcPH2+jEf4cX7/d5xPF4s4vkJS3vBd+IeeOiYXqlJzC2MuLKpTC8J6Ph3ifFX2jO4qhm31R1j1kNj6t+0W0pYsVT4ZndboiKQUyXsxXV+Yq6O4QBRYAxrZXFyyqL6tuTzUwdyPoGVHIRlawrLoyP6h+Z6TczRG6pn07JjhFpbSyzv8oy+9Hr62s6+O99shpB2MiJOdkabW5cKwuKQFZK9B2eMzY8Z2rZojGscZXV8XChX7aPTrBzSlaKB9uYXhcS2TFe1fs3Bh8rWoLnTIgouNfZch+au4MZoFvZOl/S8v2Jwdvpn6qL/7mbWflMmEdgCyL9d0x+TeQ8DM1RGVEf5B9V21se1RQYENFobLiC+n9TfqLRK+wPBnhPebn8/S63zb04jUCzlQc0+GQo+95RCchYZOif+ru5mun2SRVi/AFsT2V/ezLqJ7bOo/+rCqrzTFP1H8N5p3oF1wXLfznfcqFROWQKgxfkSLIvqVS8Trh5DuenFSF61fpHwYfxiYXvE1UYHStrCslKH6tIw2+cI4m/Iy+W/B66n7HiFtPqIQQ397dxJNvpOEuWGnHfWrslqbWqr2jyzO44TZFNmVC9Vs1t9z044OpI99AsND6NudNWWazq/UcWj7SDu809VhBZwwuLrOEV1PUnMnNZooJG+M8PWx+2Hgka4UVzeqZ7lt24vw8a4LCCeqdVx8ljZDW908qCqmRYxWytqoTKZqzb6itdPaFnLFtrJX8MVXRAW83o9q7gXjLrV82Hfc8OE5Kvr1fQ7GrfYjd8Zu1W/9t+ZbVaMwmLLOjSymYfrc/p7Rpirwx7wYmvB7CP9qAw0+U4+MHa5pDDkMPOMny3XF2ttk+pfxMMb8Bnuhf7lp9wOLt6XDAnH799a6fYNFG9qdoET/C0XIduD7wps7yiWV9pqGnqb45tSzyCoT5hUYMnDZ0oOU4UZpFtULaJto8eEioYX6mU3J/buy21KrMp8nQZc1fm9dybesmbL6B6JETx9LHx8S4BNZhWnwI7rC5bVrw2MfdI7ohOEKxDVNUfVrJvzn/fW1w7ej0uQ7F3tDGwd3fj3MQdRhoiA6sT5x/cuJyUkpPPzPCsmn4YVJtftBTILagMn5isjMwvlgLFZQHV8xPuVVk5KKAeHh8dOD8aGRrSsGGx6JjAuZGIUAYYdm2asp4Jr7Aa+vef9qAj0N1oEXkR5W7lCOWerwb3NcOu8EkgJOYQ3xFipIk3Q3VUpvftHqGZz5D0owdoUL/icoURYaqrn2QT5HUzmFYaMFBHT/e51SG2/PGHwJv7GIdLAYEhMRZGpBBSmPtksHPFcrjpWU9jW9P40y8MbBScdWiWUaeZojgKzoKorWNG8jMzTTA3XcaqWhPxmpYknMryfxWkjVfsKrrr9O6uDYR1j65VN3Q2ll53c7Kl0r2YgBEf5c2kOzpaezSlNpdKCrY31CAbqmTsKmWQzXpCbeUyNsiW+duOpjNJpjO3HecfjtCI02MTxNk7jqVO45V+5jYJ0cmX/ENaYrt8sFci9YnKip18ft1JGelV+Wla7setXa+eIZ9ozQgwAxRNJSpDSzB6DhHfYShBeUzxrG2QD3j438VTmk257fHyroxEBkN7QTGkkd2wDFk1UWuub2BxIy3D1EVXxcQETwe5Rbgmjr6WvuMc71jhdXUhwdW129XXg4Margtw4oxMcCpGZgEEMz8iQekcuZt4RAz6HWR1ZOXwW2ga4Xbgpj9QGZQlDY4qkkXtXJW7Li5Ett9IL6lNijEhRATaF4e7OgkKh9nGUOUylc51S/3j03oppbA9OjCGqVR6Jt9/KLEkryM1fEHWUFFFy0iOHgfoxULNQFMYd5ApPoUPTbSO9ixV8/uJwfOxGVKpGT4E+ZsY4D21yeK03ub8vf6I68/2OeCxzmffNHai5NEpWc52JkSa/XEqe1upeFHI0JVm9maGzTkDaVOEdJ6iQOXDE3fPVEfFovQ5vNxrRydVxyaaiTV3Jm9Uj9xr6EZ40IOtLWmBwM3anR5sZUkP8sEhryWnaTdUF6sTJEnyNyotaI6QNQYaO1pfeXQwf7emosKNLnnKHaLKKcVi3B7FVT163sgCcJXPfLTZnKx0kvXvoT2/x/fDQ4HMAAvIUU1UIx51dbVqkweGB2LqxxKGV58VFvbd2n9qdNVWkvrMi6tfQi9SWb3q1tZyUVVRteP/FlTEXcSpk23rsM02JhvbFdzNO5qa9NOYM93boZ4sG1L8nbTNvmkyPkmzU5Ex+pWoFVg9fTJjEeUn/YZ3jBWcy+sPwSYFxYVCiXuzeLbrwIeQKw+Z88JfPiI+y2CAx0J/GXgVdTVqKjEmFHJsxVg8//F+c2x7piMooMvipJalg0VZWknv1tSGzQ2ZGNw7d2ycFZmoq2Bkb6NfGlPmFjxgZUK1NapBrNG4tPLut3gt/COrSNfoocXl249662786PgMWjXMrSkWti4mKmihUsTdpdWI4Muhs9DaEfvujevcEVlxURbJMvby5neJauu6Kow1pQh5j5FGFxBC1la3NlBSbqQFhfMGJUq62Hu/5ALqHYI7dvwPG0g37UwVfF9WXLCVmPQ6Y+cb90JGoJlieSRjNM4irNwtglB8ivbq/cXelPYg87COp4a2xWHhJVcZMXkevnED1TQubr93RsqaiG1Eg4wRjUwk0G2NDR1tTc0cyPvLdc6l9jXztpM0zqvzWZktMfnvmPy+q/VxQnGdz+pCIVoj+YwFHKV9PiCicbQ8/ITNXyHP+EfV+qFQKC7DzwV4cU/Gb1lQqpWVG3vXz7w6yYFmf9j9SsV5j+H8mIs+LRg8RipKD0Q3o+K6UUUV3LBW7a4ypHApK74ZFfmlzkn3QJfZQHKTcvHlPQzlo5Y13ASdOFbznTLbU3Vx/+9kVe5kl6SVrUPr36DD6jwBRnKCLyUNbSNveZuo8UQvZi+7JLNkRfgcHM1RxagPCgir7bsW0RDgH9aAZzVauIcJBISKu9PdC9Uid3m3rxVcK9hEnka1anBEXbC/Gu1MT46kUq5EuLpfjgq3la/2qpZX6PboPqfq/TUspcL1VK2v2nMJOUihhSs0ucpV2jJG49lxObSCgeC2bLolJR2W3bJV5uK3huGVO9oWZMLy27araJ7LmPuKvEOLy7DiwQ+gCVA9/kEtGeW5MWmw6sfdZ4Cb89O/RBpPKYYVbjyL85Cr1xMZ5m+/lMt+QUnxkNd53+SEAP/U+EBRC56PebdF01CiabeRyP6qP8adfcfHfGR70ImadzoXSm0TYYUoKiqu8reTljuKl0zlUBbn+NlW0ZbQVtGB/Kklwu6fLC332VnGSUIcbVFhlWBVrJv6OcSVGOLmniRdHRl6ObRUOumw92pPXk9GUHmIrqyd66GrkD7TVvPL4sfLcG9R79NR+4ka6ZQT0zSpuay0oCYLSnwgVHxe44qKK12TpqfgZH6fNt8+b9qPQCDAuWrvUAfns8+MMvTg+/M36eP4sx/cJQOROvP98o/WHvmky+Jl01SM0RQu06kW0ixXyPb8Fu2gOzvza+W2MsD7JutSD1texGqZkxVB2tPr7+VjvQRk8bITQ3JswOj+/GqBI9U+wENTuMyY6qNOSfVgOahDpuCdZaq9uMra5uLSmiaoqKuqoa2wqKHj2gPOsgBPOHPaTlVP2RuWSUQ+yh67MzW+xtQWas0/NTQepteHhZCF+rVHpvYJuPIf9dbCzH3j1MyUS/FtFdlX+1MhrwW4sbdfGLZTW/nc/XC5hpOtRUkUfkcjvcDo1Ly4yM7rGdc66mEl2ktf9nerblkpnoqPvKCvreTp11tnWvfYLKS1+Qq2Rjc8RC1JMymoPrawoDk26GoynqHB8LsRw10ddeuOTYCvzZkcxYs5QoEkBwrJwoFS8FzBAGsdn52cEtvbnFLQ2AwqNB8/f7wn2BDgLIXTI1/XZbOI8pfHG6sFRqJQuSmf+03uT0FoAouMdV36b6ssfObQhx6LJAC5JOjRJ98RGpcOD2DRAQhya5724k8jD1h4LdidXlqFLf0sZHAuMoKD7AbsKt/0fd4/Vp3avNOQvtoYn3DQzIES+xSyatElnBRBl1EIxJbWQWNi6qCzRibfNxMqaOHTB3rsnzAXrlFKTk+Ij6npLznbZWQ9NHDQmMgeOSuV88kaWBdCjj8xcdAY+BGzkwpH7WRlK8dIdm1sakRKxZIVFUseqFiypmLJtqXBUOs/VYN0qxqkxdbQZDKinSjANtY0GVCNI2rW+QYwu3FzxP1tJrTwsMA9gQs8xgrXQUAg+piEBvc8AO9TRYB7B82uA0zKTvY9aVsiO7KMAXVr96Fvy3o5pLZl2cal7G+TUyFVKplYB8jK7gGyckCArJxkO4aSctWRmAcc7Z23QFeOs50JRMxy9qL1vQEsIWcX8+oHYP5WWo+9VD6nMDiLc6JPLoYrq2ZpweFL4V8lNE5YC4TiNRrdxrq3SZ45Yod7VSuQtwW8h29WD9RD9b36Qf2ofOoENGaJvLi9evlnscbfzfoKezWBi4ALpm9MFZ3GrBj76YeKhcuttl0XEj+tLt+hSGi9rYo30M/p7eyA/mZncQGG+fvzOIB+1KhaU7Eq93cnn/2sRH/GKclAHTBq1HryTc8B8eoWlUbzLlRPPfgx3OU/MvJRPjN91RHLfjqMCqMqVOxQbpH1YQlrhhabAAPqR2x0NtgHGNRn9ocodjiDWYl8D5aI5mxIDwAF+9rUCsQj/UhMU5U3VJcb+BZcVfymPs0fqIX6TAapZ8NwAACtg67xOwwCAw0T4LOrgnRo2wn4dkTc4jenXTU1PcGo7iuLM0qssQ2rItpq23y6rpi+xag4S7c9CdQAwHbtWVoNAGyRVTneWQiZm339JuEK2sXY7CVskr7XR2A11BempA0zJ7tp82vRP4R3iHAcG24evvJawFAFpj8UU9a6hj0EOBHtUkfMSiAthb3s8eg+1CU3iDaglTAmFQQrrIoZTf79qy+L347/dZpcBXHcIOVjkUUiWOl0X/euKL6KbNpI0NO8oGlkqcM0DXzkF0SqhkFba9VgtBv81xAHBlwEotPBK/km/UUdTbREmhlfUCARF12oGgDiZi0aBVNXh8M5J+lxPrDFdgLelkQndU26kql14QNWIDYDHMz22q3XfuV8zGCrG1e7ju7z9OZmW/xU6KRYf2n7vLg6PY6rggg/TnDCYN5ArVLRMszoi8RbvRidqBT4QRwDzbwejOvaA+FBu/snkevL36NLw0A2JSp/ZYtzXlZepEJbPG2DYoG6MMfnzY8lvR3kVohZoZs02MbZTTy0J2kUXe4iQpFA6/Q16/CHEAeSA0luC4oNhVkZSSJiWi2VzxorYN57xglrecSfIibcqwd2fIP0eMnHCOQRy92EjVPodQgCwvzBW3ZbRMeVBCtgkb0M7Iei0Yi2FSZm8KbHyNqxyMi82eCSNUMSaGykSeYom5c7tIEMVY/sbfxiB67p0EWdWBq5/i+hGD/pr3gY4jd9PpjHP/uPmyv8H6GoG/T5oZw3Ps1IjQoU80yVZ37C1NV3UJfbAZSlXdCInmskDUIG5iCLED5MEYmf/rgHy3VbNS+AmggWloUyyTmOItrE5/stmvFhYNPM6lxeTRjdPPU9Ve/Xr1ONggA/sCPoQE0wap7mMKPbAAFViIk/Bn+Ji7S3S4VXu36PTnlCUSsEYtarvpLFb1/F+Mndb+5ixD/v/rXnpCdkFWl3H8FejWJ/fuaXCuOUgV9e1n5WlZeMGASEKZXMUj8qy6RfDN7yRZKeQR+xi+8yibpBMcWr8JYneBRZo9cbECHehUqo80BiYNtw3omjF/M5s0eldajzCASsr5hcK0s3l1DTt299pdvGArEkDIs7EA/vccNVIi6c0wZOn7qomzJHjh584UG0vhu30+Xg8sRYOCbbb+I24mZnZiS1ZEXSkqT+AgWqJ4Fupjk1CV6/3y5bI00QTtfgd9cx/rn/1z6KHOnf1Y8z1V4I6rOuTndX4yf737w6yZ12vbkplXB1hSDFElpngPZrfI41eEFXYQGlc5tFNnefRLYSPXaGYW486eSiQXf60ppav6xjvNXfMgx+SdRyf0ogZjQZW2kNG3/CqxIhfqKYUISB9yxO6vkkRJXZrmTN20AiQlVPRv/1KcY/p39NMfh4iszrpslz/FTZ7DFh6iGzpfyEZNnAQPkVwDZkF6UiL/RjQtnzZZZskEDOAQDbucuWakJBarN0DFEswgS6puuQkjT7t9PbGAgPyEMnp9c40oOYitlqBHTIm7ri2diq8gUZsxUBABwGP48Zkes1fCDQmuYoZGI3hx5TNxPNd+AqXfY4BgvTgxEgoCmGMK96kGiQz0kNRYImgcl9sCG6KnlfHTG25icamjVDYqhmQEaktXTBd/FKA2WlO6tPEM63D0Mw1sYVMj6CU9MByMFCJZmy9ONZ/2FO4krErkh8EohWk2YGh4BmWzYrUqq5qK0yHE3cSQEirOm9EQa0HspGbztwhVogYVNX2agNVayCCXzI6dToMLnUBJJPJBMiB97JhYJ0ttozI59rfmCuRwz2CJLZFE7SyE70Nkh4gGObrr86QH6MKUqJLEps54zAyQriWuTRI1YCLe3zRcA4brrrp3CIodramAkf74v6besCbEANNKb1BV27bPiL3GkE1T7fLwXNlSEFltuYuICXFqGKyvtponxPoLfPKBh18MKFNDNWrJqsTOZpatqKYba35CuQpmRQL6+IWOfOIWdUfMDQ2oxA55NTAwcvkr1mxIlVk5EibFF3xrQGhxBy3sIUqhX0uNoYp+bMKOGg9gQfb7/MzYg6J+dtswyVSgmpYp7i906F1i0ZvNcLwfyXkURqI02FTvdEeeJS+7OtE9rjY8zqKCNpJmjyDYQ1u5I0D+JNE6j1qkKNvxG51x6NFHpW+LgPIRjoLhgKMOPA9CiwwtN0xAFuQoAaRDhvboQPWZIM1aQeEGkUgDyEH1nrNEAi6Bj4bxDNJRVmvRVv2f/cZ0E0hXQraGuymPpjlrnAwZ3cC5NwATly11GKZe6nsKZC/AAhapzlE5jQnhIAsMvBnvAOZ1jgbH3DyGmZbWXhK3pzilyyDMGdATrMCdTzjJQl0Mu51xbWbSYyIMSMCDasp6L6cDpqIO4lbN3EwTk3syQfRW0853SRLZNESl7vAV1E6qMZqjvdLHCjxPgadwWtRU+i7STHzMPlyrSdutoi4o0gVYln+YqYZbtso3X/nvPoPCWbTw/REtGjhHvTgoBp08sOJfi6RyoJYr/1VkfRvTgq5oZfzo+hWNALurvuKI6hWFDrqk36LKDqSo9rKQWrwCVWWdlDsLupSMl76ImTidyOTgydSOJNQ6qcWdnkMSMLvvVO6ahaZ7qmzAy3sNAk++WwKtDALiapLxRE1pwZ4qZplJmpFxwHfpYerT6CrTdBsVrbu1UU+UJjMCW+Vg6LIzGhEONsgsYJ6+ZbqhWhHsSrWeZZDtkNtu7rIi9ZWAryVCD4TMyq4f08VRjWjQJLI69T+Hqf/bpiXjtgrt/5ecxCvnwuvOg+6oG/6c5WNFIc+XuIxHsz3pacO+WYs0sxKyUilMdIQ2IUgswYswx22sOMt7cwbqKb1T1DACGa9BFHgvTIyB8B52fGatpzOq8pqw9jfnC4MC8/ZnPYQYsPs7tcNzku1D04GaeqJ3mU+FrPrhO5TkaPegxct64bPIoftcHbj/aknz+IDs+JBtS1qgO1uwOUL+lUaWMPJFh743rtHC0Gtku6bk+K8186VZ+x7QzYA0aDKiiTsgmlrJ12zwF08UHrccnFlLaP1EFW6IcqvdlT25naG+TtWYVILHQeF0dn4yOXBYV8RV4hlnarpoxa18g0MhMT+/05Rpgb8wQ8HOdbX3wYbTj7ptPhNCB6buuq6r48e3tdySigrBf+eoeA1ewHVR1yo5H1xTe7FySZKcbxP1hpzVatlSCavkx5CbAEvmSVZlYqp4mj1HnFxLpXwF0oHN33tvFkA2kzRY16Cqqr4JHQX2L1EJavoR/ycw/nyzd7a+82nuSFs93xHnp7mMj+PRKsZMrYfbcWy0zD0iSobukzVvWMZdVHwVw9mzATpBBJ/v/Sp4XW+7ALt/ALTiEwxIdsf9G/4z/yX4Rn4SD8bP7n6WP9e+2/o/ukeadasse2NvyCter3eqM6vFnz8Dasg2z68BEQiIDiKeVbXp5DlBEbB8ZJNzqZE4Yua4uXrDacLiIw/OUD4A6gArxs2h3b3DAzyK0uKXsc3H9nNZba2Hp3dqsUI/og9P5jiqbO1eypeVkTIa4xXBOtuuZtmzo7vGOOzUt1ejzcdONq/uPiqHrl+magzlezpDOrUqLcCMISrsCG7dIqJOR+bphhe3sdC++i66vZsUEqSC6AmF08/5f5ZAbivEoRDPXKlHmATCVmdKdEAz5TFlU+ySa4t+ZtaWIKthcULB/Y9dIhVqUZyGlFySmUuGa+owzQ/iK2wql3Bo98+BY3my21qVqfSVmmpB+rW+WDYInaJBXupw56Kq7vhOOwpDo/HkbpGhxFOqZI+6pPvoEBfhg8KQSaGcKLHso0uUeykZ32I5rLXU/vaJ3If4Jmeb9+jw1SU57lmvWc5fiZOuryOMe1i6IcHw6PH39MHh71ZGCt8RseItzZ8qTq2XqdwE83TSN5CIFpzWnTuadN5M5QnaZfyc02m8sWbnBDN/+DON0cXiecj18jbhMdZy76FFJixiWzAfnDUDjVY+t6RkSNxzlmF7b27NywoHDWdYp6IZElPB5OT1ZQIyyct+VZKhuf/OCZBPsuJ4+SqKEhHLdz9C7+ZTwejk+UafXTGIbpuZxmywdEGP6SwdUWX2zCE1kbbz6Y4+gNRFLRZAuihTsuCDay76qmUco0TTXhKQ8NmkY1pOFyOOgO0HpCq4QCueuCehkjF3dSTSURf+6fYFowx2z2S2Bypx6myhBqtDCdZv/yZJWs26RQK04+io8EB6uyx5k3BkbRrQenybJOCp+rP3EMaQK4WnQi6vgw3aVD5O7gr0GoOEjY8y71cHN2vNW8eRZd+ib3ZuQiQOLf5TE6Puc1wCi6e9VQLA6E1gEooi1xCjnIXPA9q/5IAtfdvIkwSOLTcH/fjf5ErBJx6cRcOBV0IAQFPf4sz//ni5iS3gDkKxDSG2VSO4VJaoJ88ShojWqQ1ISNC0k91Sq0SaXsuJfSTVnzSf7RH0QSySk5itgFzE3oyZsEmnBqEN7r7OWi9H439cuapEW6E6T0rir+eBcNeFyShzLqZAa7DrYPn68sXZ7iX2wH8GqOYP5GqsyOchrIF01DO1HX6gWjppdtlTkFEpGbIGgrQ1cEyq5E9blJ0pxJZAIypSlOMqzRkgs4baNO9MEW24t8zROmZJAO5skjHtXoO6Pf+SngTyOdfN5XlRiWpQOEGNiRbEDXvPGJIIF6BoEIWT6TcNydrGhrH9JRF0s5ir0sFVqp5I7C/WB/iM9pc9kv38Su7Wvrai93zkxQ+w8TxDCOxzVcFF/kHLvx7h1nhzwT0Tyl0RGiOdmu48X4RHmJVpg9owKHspWzpTcsh1ve2TLi0japT5BXq7b7WJ2uhEJH6GpWoLpQVnVeYb2ybmyI0QhAdfQ2jAHNRFiZjyKbUYIw1H2qANWBLSUz6YyOcNQmit+OwHg88xoYDz2j89HVvbv+13jfGCE+7t7HGNSGuMVBQ2zuuvje2orTcZg19nLKLZvYmngZh9wFqhf4a6fVKH+B8aahgc2FNfOLHQ/jYVtjmjOYpRFgxiY918BC9v99fCF5rcJQ8crJDwqEEUR7g7ONBxiYR+Tz9L47wEpiyMeNxKn08VgmbxBN1MKTX9ESiYsHb2qPCD55lvP/6UbRLJPVBCozSOUUXK5ij52lyxqXW8yM32vCwzLVy1cmDHhDiOom7AsB/tmr+AeGsTR4SPaJjvvlM35lrzL4GXt6QVtmEqfz9n7toW0smhE7V1msHIEbQvvKrlVorKjdluo3BBEBAXK1Rd/6+zs+9lfrd06ZOQDgjZ8EDwD4KGw/LlX/53xjTgQIJxiAAMazZl8AzNliqpoqxg2QJ0znLy2HFxpiNi2SG0jIQno1ZZ7ucvS+y7XrIYQZ3VyUkCvOtFoS5UIjvkquiQtJssT8Xb6kmq7ALdgE62E17I+9sDZ2fbrt08DlPE6jhKhWiYySFdt+6sJ4lln3wNGXk9y12Hes5EoyyONu9AguvUVyUpRWrDNdWEOU6AhDdW82mVaeXQq70E9lHTCuLzrTjUR2TRzDZLV+jEh9Fqw+Q0oNsc0NyG3wtYvItyJQPkClTBnVVaElz6CSGRQZMV+SqkLGdYlfyghO4amuTISmjMThvdCK519MBiEorT4P0FuKeg7gppctHnz9O5Il5FghwIdg02ykmOy6MrJdUYDsz/QOkqqSZ03w7FlsyhR3lqTOgd7uchlM2Ldcme2vvctfYg3csgXT2iQkljnH/Cm15u4pZgvvei+7HTBLfzl5god299Jbq+j218F9lPcgym6I4WKlseRr0snxCrDzoJ+DsAI4023NqHrq6ezqNtOhWi1ySo9+T+GsV4aO3l9L67zSJV+jSg4TDBScg1XUmFSaWqswq6cbnVVVyQ6rR+8CupXK4DysCoB/rbAl8Dzj4xi3UQ051uHbD8Vnu5j2RFQJA3EvAH1BFYOE4HjFj3KP45cMmi5GM0ZsGgzytfR+IO2+Aveh1yATBWUA61ZIOn8KV+UcO5/IClcMMGcL9ABAfU24dkiNwdOx+b/UcDomYEWMw8bYxMb6pjfMnyLAvchMYBEYggB/McDGAAIEYEEgga/BQYCFzTwObLpRjiP7opqSEHBTGh4aG9d2SodiZA6IOFTjn+PR7F9zAcfIoadAeO1PgeH0fQqciD97RExhcyqEp7ATCfyF+NmFdZZfKI/PP5zZnK5ZETn/oVrZeZ3/j8Drn7lO0E9ax/uCa4Q+sECvcr5UaXSOYjX2KLlQNnco3ZwlMlE21KLMoWLIMb/wt8gauYcPpwgTFJPyIJ0hwCkrKlUTOAuUadSmzrhCyPLm6IDtyDlA+pan8hvPEzlPkT94lEQ4wOMz2pRBhGvJe4jnQ0hSPc53VTR0otm0EVaRg6o1l2baChWJ03ki5kw5EqzKozx6rg3JVCTKe+Mr2FqZmNm7mMlVmiriCRhzhNMAXrb1FxAZLQo8Y/ubjBMXbjx48eEnAEmQEBRhx4gQJeY4cRIkSZEmAw1DlpwTTjqVxzj3PHkXKLiYbkQ5p7Gp5qRGy9Zq5erRZ8CQ0b2HiSTmOjbN3IIWLFmxznn8r4QdCnsOqBzROKFz5sKVG/dg0yBVmhFldjHlyXZDm8Zgl+WpFMXBEXPkKpfhnpfBpVq7b776rl6X+2Z18+CpgJcHvM2Zt+ihfyzY42PVkmU9fH1SaN2aR/wceC9TAH+BggUJUStUGIZwEaJEihZjX6xL4sS7LMFNda5IlOSqQx/ctoGlN7g99sKT4In5YwF9+g0ZNmXAoGnpOoI/FjJqzN1AhqAcT/krBnIKSipqGja0dPQMjEzMbNmxsOeEU84456Lz+fIJFovF4otup8wo71rT5aBRMWTHxmWoFdIaVh5PoDz+ALXVMH4pv269ZCHnHr9Rffq0i7CTms/mc8U4Nv06TORLwSXeNB5HirpIbPQBbnjAB21vQUzzWeVSb5SoK/Ges11vyI/c5/wOKInOASXTOXm4j4n8KADPG3pGd5I/IUE2KE3HjwFrDgBA73LwAQeAA7qPcENlrgRXDqS1nftE97fSXo3E1Sd++831vFWLEHcm+u23HzfLTOwLfz4uhpmSk3TQLGf4Wy8uZ+SZxO3hyqDeIp/sqZnUhz9uLocz6H+/VfuZ934Oo+2doHTXEtyzTPJD36Lnhym+hT7VuvGm4ig+DuWbKA5TvFf5pHKn/ED5P5p0srKhDVDvmifGJ6GtYS3+CjT5io9r5U75jfJ/8SZKdWzFJ1EVZ3b0Zy8BAA==') format('woff2');
      unicode-range: U+0000-00FF, U+0131, U+0152-0153, U+02BB-02BC, U+02C6, U+02DA, U+02DC, U+2000-206F, U+2074, U+20AC, U+2122, U+2191, U+2193, U+2212, U+2215, U+FEFF, U+FFFD;
    }



      /* GENERAL */
      [href]:focus, [tabindex]:focus, input:not([disabled]):focus, select:not([disabled]):focus, button:not([disabled]):focus {
        outline: 2px dotted #aeb0b5;
        outline-offset: 3px;
      }

      body,html {
          height: 100%;
          height: auto; /* IE 11 Fix */
          min-height: 100%;
          overflow-x: hidden;
      }
      body {
        margin: 0;
        display: -webkit-box;
        display: -ms-flexbox;
        display: flex;
        -webkit-box-orient: vertical;
        -webkit-box-direction: normal;
        -ms-flex-direction: column;
        flex-direction: column;
        margin: 0;
        background-color: #fff;
        font-family: "Roboto", "Helvetica Neue", Arial, Tahoma;
        color: rgba(27,27,27,1);
        font-size: 1.09rem;
      }
      main {
        -webkit-box-flex: 1 0 auto;
        -ms-flex: 1 0 auto;
        flex: 1 0 auto;
        padding: 20px 10px;
      }
      @media (min-width: 480px) {
        main {
          padding: 20px 40px;
        }
      }

      @media (min-width: 992px) {
        main {
          padding: 40px 83px;
        }
      }

      .bg-primary {
          color: #ffffff;
      }
      .text-white {
        color: #ffffff !important;
      }
      .container {
        width: 100%;
        padding-right: 15px;
        padding-left: 15px;
        margin-right: auto;
        margin-left: auto;
      }

      @media (min-width: 992px) {
        .container {
          max-width: 980px;
        }
      }

      .container-fluid {
        width: 100%;
        margin-right: auto;
        margin-left: auto;
      }

      .row {
        display: -webkit-box;
        display: -ms-flexbox;
        display: flex;
        -ms-flex-wrap: wrap;
        flex-wrap: wrap;
        margin-right: -15px;
        margin-left: -15px;
      }

      .col-12,.col,
      .col-lg-3,
      .col-lg-12,
      .col-lg,
      .col-xl-auto {
        position: relative;
        width: 100%;
        min-height: 1px;
        padding-right: 15px;
        padding-left: 15px;
      }
      .col-12 {
        -webkit-box-flex: 0;
        -ms-flex: 0 0 100%;
        flex: 0 0 100%;
        max-width: 100%;
      }

      .list-inline {
        padding-left: 0;
        list-style: none;
      }

      ol,
      ul,
      dl {
        margin-top: 0;
        margin-bottom: 1rem;
      }

    /* SKIPNAV */
    .usa-skipnav{
        font-family: "Roboto", "Helvetica Neue", Arial, Tahoma;
        font-size:1.06rem;
        line-height:1.5;
        background:transparent;
        left:0;
        padding:0.5rem 1rem;
        position:absolute;
        top:-3.8rem;
        -webkit-transition:all 0.2s ease-in-out;
        transition:all 0.2s ease-in-out;
        z-index:100;
    }
    .usa-skipnav:focus{
        background:white;
        left:0;
        position:absolute;
        top:0;
        -webkit-transition:all 0.2s ease-in-out;
        transition:all 0.2s ease-in-out;
    }

      /* HEADER */
html {
  box-sizing: border-box; }

*, *::after, *::before {
  box-sizing: inherit; }

.ncbi-header {
  background-color: #20558a;
  z-index: 10;
  padding: 14px 0 10px 0; }
  .ncbi-header a {
    color: inherit;
    text-decoration: none; }
  .ncbi-header a:hover {
    color: #ffffff;
    text-decoration: underline; }
  .ncbi-header .ncbi-header__logo {
    width: auto;
    float: left; }
  .ncbi-header .header-button {
    width: auto;
    margin: 1.5rem 0.3rem;
    background-color: transparent;
    color: #ffffff;
    border: 1px solid rgba(255, 255, 255, 0.5);
    font-size: 1.4rem;
    font-weight: normal;
    white-space: nowrap;
    padding: 0.8rem; }
    .ncbi-header .header-button:hover {
      background-color: #0071bc;
      text-decoration: none; }
    .ncbi-header .header-button .fa {
      margin: 0; }
    @media screen and (min-width: 600px) {
      .ncbi-header .header-button {
        font-size: 1.7rem; }
        .ncbi-header .header-button .fa {
          margin: 0 0.2rem; } }
    @media screen and (min-width: 1201px) {
      .ncbi-header .header-button {
        padding: 1rem 2rem; }
        .ncbi-header .header-button .fa {
          margin-left: 0;
          margin-right: 0.5rem; } }
  .ncbi-header .desktop-only {
    display: none; }
    @media screen and (min-width: 600px) {
      .ncbi-header .desktop-only {
        display: inherit; } }
  .ncbi-header .account-old {
    float: left;
    display: block;
    font-size: 1.4rem;
    position: relative;
    width: 30%;
    text-align: right; }
    @media screen and (min-width: 600px) {
      .ncbi-header .account-old {
        width: 30%;
        font-size: 1.7rem; } }
  .ncbi-header .logo {
    width: 245px;
    margin-top: 13px;
    margin-right: 10px;
    display: inline-block;
    margin-bottom: 5px; }
    @media (min-width: 375px) {
      .ncbi-header .logo {
        width: 280px;
        height: 42px; } }
    @media (min-width: 640px) {
      .ncbi-header .logo {
        width: 414px;
        height: 63px;
        margin-bottom: 0; } }



      /* MAIN */
      /* Title */
      h1, h2 {
        font-family: "Roboto", "Helvetica Neue", Arial, Tahoma;
      }
      h1 {
        color: #205493;
        font-size: 6rem;
        line-height: 0rem;
        margin-top:2.5rem;
      }
      h2 {
        font-size: 1.6rem;
        margin-top: 15px;
      }

      @media (min-width: 480px){
        h1 {
          font-size: 8rem;
          line-height: 0.5rem;
          margin-top:3rem;
        }
        h2 {
          font-size: 2rem;
          margin-top: 40px;
        }
      }

      /* Content */

      @media (min-width: 640px) and (max-width: 991px) {
        .flex-child, .flex-child ul li {
          text-align: center;
          margin-right: auto;
          margin-left: auto;
        }
        .flex-child:not(:last-child), .flex-child ul li:not(:last-child)  {
          margin-bottom: 20px !important;
        }

      }

      @media (min-width: 992px) {
        .usa-search {
          margin-right: -5px;
        }
      }

      .usa-button{
        display: block;
        margin: 1em auto;
      }

      .usa-search {
        -webkit-box-pack: center;
        -ms-flex-pack: center;
        justify-content: center;
      }

      .usa-input  {
        height:2.45em;
        width: 100%;
        border: 1px solid #666666;
      }
      .usa-button__search {
        height: 2.32em!important;
      }

      @media (min-width: 480px) {
        .usa-input {
          width: 60%;
          max-width: 300px;
        }
      }
      @media (min-width: 640px) {
        .usa-button {
          display: inline-block;
          margin: 0 1em 0 0;
        }
      }
      @media (min-width: 992px) {
        .usa-input {
          width: calc(100% - 92px);
          max-width: none;
        }
      }
      .usa-button span{
        display: none;
      }
      @media all and (min-width: 480px){
        .usa-button span{
          display: inline-block;
        }
      }


      /* FOOTER */
footer {
  margin-top: auto;
  letter-spacing: 0.5px; }
  footer ol, footer ul, footer dl {
    margin-top: 0;
    margin-bottom: 1rem; }
  footer .social_media a {
    width: 35px;
    height: 35px;
    display: inline-block;
    margin-right: 5px; }
  footer .pt-5, footer .py-5 {
    padding-top: 1rem; }
    @media (min-width: 992px) {
      footer .pt-5, footer .py-5 {
        padding-top: 3rem; } }
  footer .bottom-links {
    margin: 0 auto; }
  footer .bottom-links ul {
    list-style: none;
    padding-left: 0px;
    display: -webkit-inline-box;
    display: -ms-inline-flexbox;
    display: inline-flex;
    -webkit-box-orient: horizontal;
    -webkit-box-direction: normal;
    -ms-flex-direction: row;
    flex-direction: row;
    -ms-flex-wrap: nowrap;
    flex-wrap: nowrap;
    -webkit-box-pack: center;
    -ms-flex-pack: center;
    justify-content: center; }
  footer .bottom-links ul li {
    padding: 0px 8px;
    position: relative;
    font-size: 18px; }
  footer .bottom-links ul li:first-child {
    padding-left: 0px; }
  footer .bottom-links ul li:not(:last-child) {
    border-right: 1px solid #FFFFFF; }

@media (min-width: 992px) {
  .col-lg-3 {
    -webkit-box-flex: 0;
    -ms-flex: 0 0 25%;
    flex: 0 0 25%;
    max-width: 25%; }
  .col-lg-12 {
    -webkit-box-flex: 0;
    -ms-flex: 0 0 100%;
    flex: 0 0 100%;
    max-width: 100%; }
  .centered-lg {
    display: -webkit-box;
    display: -ms-flexbox;
    display: flex;
    -webkit-box-pack: center;
    -ms-flex-pack: center;
    justify-content: center; } }

.icon_social {
  width: 35px;
  height: 35px;
  display: inline-block;
  margin-right: 5px;
  margin-bottom: 1rem; }

.icon-section {
  background-color: #dbdbdb; }

.icon-section_header {
  background-color: #90a6c7;
  text-align: center;
  color: #fff;
  text-transform: uppercase;
  font-size: 18px;
  font-weight: bold;
  padding: 16px;
  margin-top: 50px; }

.icon-section_header::after {
  display: none;
  content: "";
  border: solid #fff;
  border-width: 0px 3px 3px 0px;
  padding: 7px;
  -ms-transform: rotate(45deg);
  transform: rotate(45deg);
  -webkit-transform: rotate(45deg);
  margin-left: 15px;
  position: absolute;
  margin-top: -2px; }

.icon-section_header.opened::after {
  -ms-transform: rotate(-135deg);
  transform: rotate(-135deg);
  -webkit-transform: rotate(-135deg);
  margin-top: 6px; }

.icon-section_container {
  display: -webkit-box;
  display: -ms-flexbox;
  display: flex;
  -webkit-box-pack: justify;
  -ms-flex-pack: justify;
  justify-content: space-between; }

.icon-section_header.opened + .grid-container .icon-section_container {
  display: -webkit-box;
  display: -ms-flexbox;
  display: flex; }

.footer-icon {
  display: block;
  width: 40px;
  height: 40px;
  margin: 20px 0; }

/* Added after adding USWDS */
.bg-primary {
  background-color: #20558A; }

.icon-section_header {
  background-color: #4773aa; }


      footer p {
        line-height: 1.5em;
        margin-top: 0;
        margin-bottom: 10px;
      }
      @media (min-width: 992px) {
        footer .pt-5,
        footer .py-5 {
          padding-top: 30px;
        }
      }
      footer .mt-3,
      footer .my-3 {
        margin-top: 10px;
      }
      footer .mt-3 li {
        margin-bottom: 0.3em;
      }

      /* ADDITIONAL NWDS OVERRIDES */
      .usa-grid{
          margin-left:auto;
          margin-right:auto;
          padding-right:15px;
          padding-left:15px;
        }

        .usa-grid::after{
          clear:both;
          content:"";
          display:block;
        }

        @media screen and (min-width: 600px) {
          .usa-grid{
            padding-right:30px;
            padding-left:30px;
          }
        }


        @media screen and (min-width: 992px) {
          .usa-grid {
            max-width:980px;
          }

        }

      .list-inline {
        padding-left: 0;
        list-style: none;
      }
      .list-inline-item {
        display: inline-block;
      }
      a {
        text-decoration: none;
      }
      </style>
</head>
<body >
    <a class="usa-skipnav" href="#main_content">Skip to main content</a>
    <section class="usa-banner">
      <div class="usa-accordion">
        <header class="usa-banner-header">
          <div class="usa-grid usa-banner-inner">
            <img src="https://www.ncbi.nlm.nih.gov/coreutils/uswds/img/favicons/favicon-57.png" alt="U.S. flag" />
            <p>An official website of the United States government</p>
            <button
                    class="usa-accordion-button usa-banner-button"
                    aria-expanded="false"
                    aria-controls="gov-banner-top"
            >
              <span class="usa-banner-button-text">Here's how you know</span>
            </button>
          </div>
        </header>
        <div
                class="usa-banner-content usa-grid usa-accordion-content"
                id="gov-banner-top"
        >
          <div class="usa-banner-guidance-gov usa-width-one-half">
            <img
                    class="usa-banner-icon usa-media_block-img"
                    src="https://www.ncbi.nlm.nih.gov/coreutils/uswds/img/icon-dot-gov.svg"
                    alt="Dot gov"
            />
            <div class="usa-media_block-body">
              <p>
                <strong>The .gov means it’s official.</strong>
                <br />
                Federal government websites often end in .gov or .mil. Before
                sharing sensitive information, make sure you’re on a federal
                government site.
              </p>
            </div>
          </div>
          <div class="usa-banner-guidance-ssl usa-width-one-half">
            <img
                    class="usa-banner-icon usa-media_block-img"
                    src="https://www.ncbi.nlm.nih.gov/coreutils/uswds/img/icon-https.svg"
                    alt="Https"
            />
            <div class="usa-media_block-body">
              <p>
                <strong>The site is secure.</strong>
                <br />
                The <strong>https://</strong> ensures that you are connecting to the
                official website and that any information you provide is encrypted
                and transmitted securely.
              </p>
            </div>
          </div>
        </div>
      </div>
    </section>
    <div class="usa-overlay"></div>
    <header class="ncbi-header bg-primary">
      <div class="usa-grid">
          <div class="usa-width-one-whole">
          <div class="ncbi-header__logo">
            <a href="https://www.ncbi.nlm.nih.gov/" class="logo" aria-label="NCBI Logo">
              <svg xmlns="http://www.w3.org/2000/svg" viewBox="0 0 2039.55 243.26">
                <defs>
                  <style>
                    .cls-1 {
                      fill: #fff!important;
                    }
                  </style>
                </defs>
                <g id="Layer_2" data-name="Layer 2">
                  <g id="Text_outlines" data-name="Text outlines">
                    <path class="cls-1"
                      d="M266.77,67.24V176H248.18v-49.2H199.53V176H180.4V67.24H199v43.19h48.66V67.24ZM161.26,176H142.68V67.24h18.58Zm-37.17,0H104.41L55.76,96.21h-.55V176h-18V67.24H56.85l49.2,79.81h.55V67.24h18V176Zm208.83-54.66L266.77,0H21.87A22.05,22.05,0,0,0,0,22.41V220.85a22.05,22.05,0,0,0,21.87,22.41H266.22Z" />
                    <path class="cls-1"
                      d="M283.17,242.72l66.69-121.36L283.17,0h16.4c9.29,0,20.23,6.56,24.6,14.76l58.49,106.6L324.17,228c-4.37,8.2-15.31,14.76-24.6,14.76Z" />
                    <path class="cls-1"
                      d="M428.15,31.14h16.5L485.4,96.89h.25V31.14h14.88v89.25H484L443.4,54.76H443v65.63H428.15Z" />
                    <path class="cls-1"
                      d="M571.15,106a7.54,7.54,0,0,0,.69,3.75,2.9,2.9,0,0,0,2.69,1.13H576a9.16,9.16,0,0,0,2-.25v9.87c-.5.17-1.15.36-1.94.57s-1.61.39-2.44.56-1.67.29-2.5.37a20,20,0,0,1-2.12.13,13.78,13.78,0,0,1-7.25-1.75q-2.88-1.76-3.75-6.13a25.29,25.29,0,0,1-10.44,6,41.17,41.17,0,0,1-11.94,1.88,29.25,29.25,0,0,1-8.37-1.19,22,22,0,0,1-7.07-3.5,16.81,16.81,0,0,1-4.87-5.87,18.11,18.11,0,0,1-1.81-8.32,19.18,19.18,0,0,1,2.18-9.75,16.27,16.27,0,0,1,5.75-5.87,25.79,25.79,0,0,1,8-3.06,90.4,90.4,0,0,1,8.94-1.44,70.49,70.49,0,0,1,7.38-1.06A34.66,34.66,0,0,0,552,81a9.49,9.49,0,0,0,4.25-2.31A6.37,6.37,0,0,0,557.78,74a7.28,7.28,0,0,0-1.32-4.5,8.78,8.78,0,0,0-3.25-2.68,13.68,13.68,0,0,0-4.31-1.25,34.25,34.25,0,0,0-4.5-.32,17.93,17.93,0,0,0-9.87,2.5,9.74,9.74,0,0,0-4.38,7.75H515.9a21.45,21.45,0,0,1,3-10.37,20.76,20.76,0,0,1,6.69-6.63,27.57,27.57,0,0,1,9.19-3.5,55.13,55.13,0,0,1,10.5-1,44.65,44.65,0,0,1,9.37,1A26.74,26.74,0,0,1,563,58.26a18,18,0,0,1,5.94,5.82,15.93,15.93,0,0,1,2.25,8.68ZM556.9,88a17.36,17.36,0,0,1-8,2.57c-3.17.29-6.33.73-9.5,1.31A30,30,0,0,0,535,93a12.93,12.93,0,0,0-3.75,1.88A8.22,8.22,0,0,0,528.71,98a10.78,10.78,0,0,0-.93,4.69,6,6,0,0,0,1.37,4,10,10,0,0,0,3.31,2.56,15.17,15.17,0,0,0,4.25,1.31,26.44,26.44,0,0,0,4.19.38,23.14,23.14,0,0,0,5.13-.63,16.81,16.81,0,0,0,5.18-2.12,13.72,13.72,0,0,0,4.07-3.81,9.69,9.69,0,0,0,1.62-5.69Z" />
                    <path class="cls-1"
                      d="M580,55.76h10.75V36.39H605V55.76H617.9V66.39H605v34.5a35.69,35.69,0,0,0,.18,3.87,6.71,6.71,0,0,0,.88,2.75,4.15,4.15,0,0,0,2.06,1.69,10.07,10.07,0,0,0,3.75.56q1.5,0,3-.06a14.79,14.79,0,0,0,3-.44v11l-4.62.5a41.2,41.2,0,0,1-4.63.25,31.47,31.47,0,0,1-9.06-1.06,12.17,12.17,0,0,1-5.38-3.12,10.85,10.85,0,0,1-2.62-5.19,38.6,38.6,0,0,1-.81-7.13V66.39H580Z" />
                    <path class="cls-1" d="M628.52,31.14h14.25v13.5H628.52Zm0,24.62h14.25v64.63H628.52Z" />
                    <path class="cls-1"
                      d="M687.9,122.14a35.31,35.31,0,0,1-13.81-2.56,29.4,29.4,0,0,1-10.25-7.07,30.09,30.09,0,0,1-6.38-10.75,43.85,43.85,0,0,1,0-27.37,30.09,30.09,0,0,1,6.38-10.75,29.25,29.25,0,0,1,10.25-7.06,38.39,38.39,0,0,1,27.62,0A29.34,29.34,0,0,1,712,63.64a30.24,30.24,0,0,1,6.38,10.75,44,44,0,0,1,0,27.37A30.24,30.24,0,0,1,712,112.51a29.5,29.5,0,0,1-10.25,7.07A35.31,35.31,0,0,1,687.9,122.14Zm0-11.25a16.37,16.37,0,0,0,8.25-2,17.35,17.35,0,0,0,5.75-5.25,23,23,0,0,0,3.31-7.31,32.91,32.91,0,0,0,0-16.57,22.18,22.18,0,0,0-3.31-7.31,17.83,17.83,0,0,0-5.75-5.19,18,18,0,0,0-16.5,0,17.83,17.83,0,0,0-5.75,5.19,22,22,0,0,0-3.31,7.31,32.61,32.61,0,0,0,0,16.57,22.83,22.83,0,0,0,3.31,7.31,17.35,17.35,0,0,0,5.75,5.25A16.37,16.37,0,0,0,687.9,110.89Z" />
                    <path class="cls-1"
                      d="M732.4,55.76h13.5v9.5l.25.25a23.83,23.83,0,0,1,8.5-8.43A22.56,22.56,0,0,1,766.27,54q10.62,0,16.75,5.5T789.15,76v44.38H774.9V79.76q-.25-7.62-3.25-11.06t-9.38-3.44a15.41,15.41,0,0,0-6.5,1.32,14,14,0,0,0-4.87,3.62,17,17,0,0,0-3.13,5.44,19.38,19.38,0,0,0-1.12,6.62v38.13H732.4Z" />
                    <path class="cls-1"
                      d="M858.27,106a7.54,7.54,0,0,0,.69,3.75,2.9,2.9,0,0,0,2.69,1.13h1.5a9.16,9.16,0,0,0,2-.25v9.87c-.5.17-1.15.36-1.94.57s-1.61.39-2.44.56-1.67.29-2.5.37a20,20,0,0,1-2.12.13,13.78,13.78,0,0,1-7.25-1.75q-2.88-1.76-3.75-6.13a25.29,25.29,0,0,1-10.44,6,41.17,41.17,0,0,1-11.94,1.88A29.25,29.25,0,0,1,814.4,121a22.07,22.07,0,0,1-7.07-3.5,16.81,16.81,0,0,1-4.87-5.87,18.11,18.11,0,0,1-1.81-8.32,19.29,19.29,0,0,1,2.18-9.75,16.27,16.27,0,0,1,5.75-5.87,25.89,25.89,0,0,1,8-3.06,90.4,90.4,0,0,1,8.94-1.44,70.49,70.49,0,0,1,7.38-1.06A34.66,34.66,0,0,0,839.08,81a9.43,9.43,0,0,0,4.25-2.31A6.33,6.33,0,0,0,844.9,74a7.28,7.28,0,0,0-1.32-4.5,8.7,8.7,0,0,0-3.25-2.68A13.68,13.68,0,0,0,836,65.58a34.25,34.25,0,0,0-4.5-.32,17.93,17.93,0,0,0-9.87,2.5,9.74,9.74,0,0,0-4.38,7.75H803a21.45,21.45,0,0,1,3-10.37,20.76,20.76,0,0,1,6.69-6.63A27.57,27.57,0,0,1,821.9,55a55.13,55.13,0,0,1,10.5-1,44.65,44.65,0,0,1,9.37,1,26.65,26.65,0,0,1,8.31,3.25A18,18,0,0,1,856,64.08a15.93,15.93,0,0,1,2.25,8.68ZM844,88a17.36,17.36,0,0,1-8,2.57c-3.17.29-6.33.73-9.5,1.31A30,30,0,0,0,822.15,93a12.93,12.93,0,0,0-3.75,1.88A8.22,8.22,0,0,0,815.83,98a10.78,10.78,0,0,0-.93,4.69,6,6,0,0,0,1.37,4,10,10,0,0,0,3.31,2.56,15.27,15.27,0,0,0,4.25,1.31,26.55,26.55,0,0,0,4.19.38,23.14,23.14,0,0,0,5.13-.63,16.81,16.81,0,0,0,5.18-2.12,13.72,13.72,0,0,0,4.07-3.81A9.69,9.69,0,0,0,844,98.64Z" />
                    <path class="cls-1" d="M874,31.14h14.25v89.25H874Z" />
                    <path class="cls-1" d="M940.52,31.14h15.63v75.75h45.37v13.5h-61Z" />
                    <path class="cls-1" d="M1010.65,31.14h14.25v13.5h-14.25Zm0,24.62h14.25v64.63h-14.25Z" />
                    <path class="cls-1"
                      d="M1040.77,31.14H1055v33h.25a19.61,19.61,0,0,1,3.63-4.25,22.61,22.61,0,0,1,4.68-3.19,24.84,24.84,0,0,1,5.38-2,23.25,23.25,0,0,1,5.56-.69,30.88,30.88,0,0,1,13.31,2.69,26.21,26.21,0,0,1,9.44,7.38A32,32,0,0,1,1102.9,75a46.38,46.38,0,0,1,1.87,13.38,47.08,47.08,0,0,1-1.69,12.62,32.79,32.79,0,0,1-5.12,10.82,25,25,0,0,1-21.06,10.31,50.47,50.47,0,0,1-6.57-.44A24.4,24.4,0,0,1,1064,120a21.45,21.45,0,0,1-5.44-3.25,15.76,15.76,0,0,1-4.06-5.25h-.25v8.88h-13.5Zm49.75,57a32.14,32.14,0,0,0-1.12-8.5,23,23,0,0,0-3.38-7.31,17.35,17.35,0,0,0-5.62-5.13,15.32,15.32,0,0,0-7.75-1.94q-9,0-13.57,6.25t-4.56,16.63a33.14,33.14,0,0,0,1.19,9.06,20.45,20.45,0,0,0,3.56,7.19,17.79,17.79,0,0,0,5.69,4.75,16.19,16.19,0,0,0,7.69,1.75,16,16,0,0,0,8.25-2,17.37,17.37,0,0,0,5.56-5.19,20.85,20.85,0,0,0,3.12-7.25A36.57,36.57,0,0,0,1090.52,88.14Z" />
                    <path class="cls-1"
                      d="M1116.77,55.76h13.37v12.5h.25a14.47,14.47,0,0,1,2.44-5.12,23.55,23.55,0,0,1,4.38-4.56,22.05,22.05,0,0,1,5.68-3.32,17.13,17.13,0,0,1,6.38-1.25,31.47,31.47,0,0,1,3.44.13l1.93.25V68.14c-1-.17-2-.31-3.06-.44a26.73,26.73,0,0,0-3.06-.19,16.32,16.32,0,0,0-6.81,1.44,15.76,15.76,0,0,0-5.57,4.25,21,21,0,0,0-3.75,6.94,30.24,30.24,0,0,0-1.37,9.5v30.75h-14.25Z" />
                    <path class="cls-1"
                      d="M1214.89,106a7.54,7.54,0,0,0,.69,3.75,2.9,2.9,0,0,0,2.69,1.13h1.5a9.16,9.16,0,0,0,2-.25v9.87c-.5.17-1.15.36-1.94.57s-1.6.39-2.44.56-1.66.29-2.5.37a20,20,0,0,1-2.12.13,13.78,13.78,0,0,1-7.25-1.75q-2.88-1.76-3.75-6.13a25.22,25.22,0,0,1-10.44,6,41.07,41.07,0,0,1-11.94,1.88A29.3,29.3,0,0,1,1171,121a21.91,21.91,0,0,1-7.06-3.5,16.73,16.73,0,0,1-4.88-5.87,18.11,18.11,0,0,1-1.81-8.32,19.18,19.18,0,0,1,2.19-9.75,16.11,16.11,0,0,1,5.75-5.87,25.69,25.69,0,0,1,8-3.06,89.73,89.73,0,0,1,8.93-1.44,70.87,70.87,0,0,1,7.38-1.06,34.94,34.94,0,0,0,6.19-1.07A9.54,9.54,0,0,0,1200,78.7a6.37,6.37,0,0,0,1.56-4.69,7.34,7.34,0,0,0-1.31-4.5,8.86,8.86,0,0,0-3.25-2.68,13.74,13.74,0,0,0-4.32-1.25,34.25,34.25,0,0,0-4.5-.32,17.93,17.93,0,0,0-9.87,2.5,9.76,9.76,0,0,0-4.38,7.75h-14.25a21.45,21.45,0,0,1,3-10.37,20.76,20.76,0,0,1,6.69-6.63,27.57,27.57,0,0,1,9.19-3.5,55.13,55.13,0,0,1,10.5-1,44.65,44.65,0,0,1,9.37,1,26.71,26.71,0,0,1,8.32,3.25,18,18,0,0,1,5.93,5.82,15.93,15.93,0,0,1,2.25,8.68Zm-14.25-18a17.32,17.32,0,0,1-8,2.57q-4.74.44-9.5,1.31a30,30,0,0,0-4.37,1.06,12.93,12.93,0,0,0-3.75,1.88,8.1,8.1,0,0,0-2.56,3.12,10.63,10.63,0,0,0-.94,4.69,6,6,0,0,0,1.37,4,9.94,9.94,0,0,0,3.32,2.56,15.07,15.07,0,0,0,4.25,1.31,26.33,26.33,0,0,0,4.18.38,23.07,23.07,0,0,0,5.13-.63,17,17,0,0,0,5.19-2.12,13.8,13.8,0,0,0,4.06-3.81,9.69,9.69,0,0,0,1.62-5.69Z" />
                    <path class="cls-1"
                      d="M1230.27,55.76h13.37v12.5h.25a14.47,14.47,0,0,1,2.44-5.12,23.55,23.55,0,0,1,4.38-4.56,22.05,22.05,0,0,1,5.68-3.32,17.13,17.13,0,0,1,6.38-1.25,31.6,31.6,0,0,1,3.44.13l1.93.25V68.14c-1-.17-2-.31-3.06-.44a26.73,26.73,0,0,0-3.06-.19,16.32,16.32,0,0,0-6.81,1.44,15.76,15.76,0,0,0-5.57,4.25,21,21,0,0,0-3.75,6.94,30.24,30.24,0,0,0-1.37,9.5v30.75h-14.25Z" />
                    <path class="cls-1"
                      d="M1267.14,55.76h15.63L1299.64,104h.25l16.38-48.25h14.87L1306,123.89c-1.17,2.91-2.31,5.71-3.44,8.37a30.11,30.11,0,0,1-4.12,7.07,17.89,17.89,0,0,1-6.07,4.87,20.62,20.62,0,0,1-9.25,1.81,64.81,64.81,0,0,1-9.87-.75v-12c1.16.17,2.29.36,3.37.57a18.63,18.63,0,0,0,3.38.31,11.51,11.51,0,0,0,4.12-.63,6.74,6.74,0,0,0,2.69-1.81,11.22,11.22,0,0,0,1.81-2.81,28.64,28.64,0,0,0,1.38-3.75l1.62-5Z" />
                    <path class="cls-1"
                      d="M1403.52,122.14a35.31,35.31,0,0,1-13.81-2.56,29.4,29.4,0,0,1-10.25-7.07,30.09,30.09,0,0,1-6.38-10.75,43.85,43.85,0,0,1,0-27.37,30.09,30.09,0,0,1,6.38-10.75,29.25,29.25,0,0,1,10.25-7.06,38.39,38.39,0,0,1,27.62,0,29.34,29.34,0,0,1,10.25,7.06A30.24,30.24,0,0,1,1434,74.39a44,44,0,0,1,0,27.37,30.24,30.24,0,0,1-6.38,10.75,29.5,29.5,0,0,1-10.25,7.07A35.35,35.35,0,0,1,1403.52,122.14Zm0-11.25a16.42,16.42,0,0,0,8.25-2,17.35,17.35,0,0,0,5.75-5.25,23,23,0,0,0,3.31-7.31,32.91,32.91,0,0,0,0-16.57,22.18,22.18,0,0,0-3.31-7.31,17.83,17.83,0,0,0-5.75-5.19,18,18,0,0,0-16.5,0,17.73,17.73,0,0,0-5.75,5.19,22,22,0,0,0-3.31,7.31,32.61,32.61,0,0,0,0,16.57,22.83,22.83,0,0,0,3.31,7.31,17.25,17.25,0,0,0,5.75,5.25A16.37,16.37,0,0,0,1403.52,110.89Z" />
                    <path class="cls-1"
                      d="M1441.64,55.76h10.63V50.39a27.59,27.59,0,0,1,1.5-9.94,14,14,0,0,1,4-5.87,13,13,0,0,1,5.68-2.75,31.62,31.62,0,0,1,6.69-.69,41,41,0,0,1,10,.87V43.14a19.9,19.9,0,0,0-2.94-.56,30.26,30.26,0,0,0-3.68-.19,8.73,8.73,0,0,0-4.94,1.37c-1.38.92-2.06,2.71-2.06,5.38v6.62h12.12V66.39h-12.12v54h-14.25v-54h-10.63Z" />
                    <path class="cls-1"
                      d="M1523.89,31.14h22L1570.51,101h.25l24-69.87h21.75v89.25h-14.87V51.51h-.25l-24.75,68.88h-12.88L1539,51.51h-.25v68.88h-14.87Z" />
                    <path class="cls-1"
                      d="M1644.39,91.76a24.75,24.75,0,0,0,1.06,7.25,17.8,17.8,0,0,0,3.19,6.13,15.45,15.45,0,0,0,5.37,4.19,17.77,17.77,0,0,0,7.75,1.56q6.26,0,10.07-2.69a15.89,15.89,0,0,0,5.68-8.06H1691a26.76,26.76,0,0,1-10.5,16.31,28.53,28.53,0,0,1-8.68,4.25,35,35,0,0,1-10.07,1.44,34.36,34.36,0,0,1-13.5-2.5,27.91,27.91,0,0,1-9.93-7,29.73,29.73,0,0,1-6.13-10.75,43.83,43.83,0,0,1-2.06-13.75,38.84,38.84,0,0,1,2.19-13.06,33.28,33.28,0,0,1,6.25-10.88A29.3,29.3,0,0,1,1661.39,54a29.07,29.07,0,0,1,13.69,3.19,30.14,30.14,0,0,1,10.06,8.44A34.3,34.3,0,0,1,1691,77.7a37,37,0,0,1,.94,14.06Zm33.25-9.37a23.13,23.13,0,0,0-1.44-6.5,17.23,17.23,0,0,0-3.25-5.44,16.07,16.07,0,0,0-5-3.75,14.72,14.72,0,0,0-6.56-1.44,17,17,0,0,0-6.81,1.32,15.36,15.36,0,0,0-5.25,3.62,17.84,17.84,0,0,0-3.5,5.44,18.76,18.76,0,0,0-1.44,6.75Z" />
                    <path class="cls-1"
                      d="M1763.64,120.39h-13.5v-8.75h-.25a16.91,16.91,0,0,1-8.38,8.06,28.26,28.26,0,0,1-11.62,2.44,30.85,30.85,0,0,1-13.31-2.69,26.5,26.5,0,0,1-9.44-7.31,31.27,31.27,0,0,1-5.63-10.94,47.43,47.43,0,0,1-1.87-13.56A43.46,43.46,0,0,1,1702,72.51a30.33,30.33,0,0,1,6.32-10.5,24.3,24.3,0,0,1,9-6.06A28.64,28.64,0,0,1,1727.64,54a34,34,0,0,1,6.12.57,26.68,26.68,0,0,1,6,1.81,23.33,23.33,0,0,1,5.32,3.19,17.84,17.84,0,0,1,4.06,4.56h.25v-33h14.25Zm-49.75-31.63a31.5,31.5,0,0,0,1.06,8.13,22.18,22.18,0,0,0,3.25,7.12,15.81,15.81,0,0,0,13.56,6.88,16,16,0,0,0,8.19-2,17,17,0,0,0,5.63-5.25,24.09,24.09,0,0,0,3.25-7.31,33.12,33.12,0,0,0,1.06-8.32q0-10.74-4.81-16.75a15.87,15.87,0,0,0-13.07-6,16.06,16.06,0,0,0-8.43,2.07A17.21,17.21,0,0,0,1718,72.7a22.21,22.21,0,0,0-3.12,7.5A38.78,38.78,0,0,0,1713.89,88.76Z" />
                    <path class="cls-1" d="M1779.51,31.14h14.25v13.5h-14.25Zm0,24.62h14.25v64.63h-14.25Z" />
                    <path class="cls-1"
                      d="M1852.89,77.39q-.89-6-4.82-9.06a15.62,15.62,0,0,0-9.93-3.07,20.65,20.65,0,0,0-5.88.94,14,14,0,0,0-5.75,3.5,19.49,19.49,0,0,0-4.37,7.13,33.82,33.82,0,0,0-1.75,11.93,35.16,35.16,0,0,0,.93,8,22.05,22.05,0,0,0,3,7.13,16.3,16.3,0,0,0,5.32,5.06,15.1,15.1,0,0,0,7.87,1.94,14.29,14.29,0,0,0,10.31-3.88q4.07-3.87,5.07-10.87h14.25q-2,12.63-9.57,19.31t-20.06,6.69a33.22,33.22,0,0,1-13.44-2.56,28.68,28.68,0,0,1-9.81-7A29.59,29.59,0,0,1,1808.2,102a41.12,41.12,0,0,1-2.06-13.25,45,45,0,0,1,2-13.62,31.05,31.05,0,0,1,6-11.06,28,28,0,0,1,9.93-7.38A33.59,33.59,0,0,1,1838,54a38.93,38.93,0,0,1,10.69,1.44,28.42,28.42,0,0,1,9,4.31,23.17,23.17,0,0,1,6.44,7.25,25.06,25.06,0,0,1,3,10.38Z" />
                    <path class="cls-1" d="M1879.14,31.14h14.25v13.5h-14.25Zm0,24.62h14.25v64.63h-14.25Z" />
                    <path class="cls-1"
                      d="M1908.89,55.76h13.5v9.5l.25.25a23.83,23.83,0,0,1,8.5-8.43A22.56,22.56,0,0,1,1942.76,54q10.62,0,16.75,5.5t6.13,16.5v44.38h-14.25V79.76q-.26-7.62-3.25-11.06t-9.38-3.44a15.41,15.41,0,0,0-6.5,1.32,14,14,0,0,0-4.87,3.62,17,17,0,0,0-3.13,5.44,19.38,19.38,0,0,0-1.12,6.62v38.13h-14.25Z" />
                    <path class="cls-1"
                      d="M1991.76,91.76a24.75,24.75,0,0,0,1.06,7.25,17.8,17.8,0,0,0,3.19,6.13,15.48,15.48,0,0,0,5.38,4.19,17.74,17.74,0,0,0,7.75,1.56q6.24,0,10.06-2.69a15.9,15.9,0,0,0,5.69-8.06h13.5a26.88,26.88,0,0,1-10.5,16.31,28.59,28.59,0,0,1-8.69,4.25,34.91,34.91,0,0,1-10.06,1.44,34.29,34.29,0,0,1-13.5-2.5,27.94,27.94,0,0,1-9.94-7,29.73,29.73,0,0,1-6.13-10.75,43.83,43.83,0,0,1-2.06-13.75,38.84,38.84,0,0,1,2.19-13.06A33.46,33.46,0,0,1,1986,64.2,29.3,29.3,0,0,1,2008.76,54a29,29,0,0,1,13.69,3.19,30.14,30.14,0,0,1,10.06,8.44,34.13,34.13,0,0,1,5.81,12.06,37,37,0,0,1,.94,14.06ZM2025,82.39a23.13,23.13,0,0,0-1.44-6.5,17.23,17.23,0,0,0-3.25-5.44,16.07,16.07,0,0,0-5-3.75,14.69,14.69,0,0,0-6.56-1.44,17,17,0,0,0-6.81,1.32,15.55,15.55,0,0,0-5.25,3.62,17.84,17.84,0,0,0-3.5,5.44,18.76,18.76,0,0,0-1.44,6.75Z" />
                    <path class="cls-1"
                      d="M438.78,164.56l19.12,44.33h.15L467,164.56h6.9l-11.33,53.55H454.9l-19-44h-.15l-9.08,44h-6.9l11.33-53.55Z" />
                    <path class="cls-1"
                      d="M479.39,185.45a14.1,14.1,0,0,1,3.79-3.94,15.83,15.83,0,0,1,5.1-2.32,23.15,23.15,0,0,1,5.92-.75,31.06,31.06,0,0,1,5.4.45,13.69,13.69,0,0,1,4.5,1.57,8.55,8.55,0,0,1,3.11,3,9.13,9.13,0,0,1,1.17,4.84,16.68,16.68,0,0,1-.42,3.56c-.27,1.27-.53,2.44-.78,3.49L504.7,206c-.15.8-.36,1.7-.64,2.7a11,11,0,0,0-.41,2.85,2.64,2.64,0,0,0,.53,1.88,1.82,1.82,0,0,0,1.35.52,3.12,3.12,0,0,0,1-.19l1-.33-1,4.72a12.34,12.34,0,0,1-1.92.56,8.91,8.91,0,0,1-2,.27,5.23,5.23,0,0,1-4-1.43,4.69,4.69,0,0,1-1.05-4l-.15-.15a13.35,13.35,0,0,1-5,4.12,18.69,18.69,0,0,1-8,1.43,17.94,17.94,0,0,1-4.62-.57,9.5,9.5,0,0,1-3.71-1.87,9.3,9.3,0,0,1-2.51-3.38,12.1,12.1,0,0,1-.94-5.06,10.71,10.71,0,0,1,1.84-6.67,11.57,11.57,0,0,1,4.69-3.64,23.14,23.14,0,0,1,6.3-1.69q3.45-.45,6.67-.75c1.7-.15,3.16-.31,4.39-.49a9.91,9.91,0,0,0,3-.86,3.81,3.81,0,0,0,1.76-1.72,7.06,7.06,0,0,0,.56-3.08,4.07,4.07,0,0,0-.75-2.55,5.39,5.39,0,0,0-1.87-1.54,8.85,8.85,0,0,0-2.52-.78,16.59,16.59,0,0,0-2.66-.23,17,17,0,0,0-3.56.38,10.28,10.28,0,0,0-3.19,1.23,8.35,8.35,0,0,0-2.4,2.18,7.13,7.13,0,0,0-1.27,3.19H477.4A13.45,13.45,0,0,1,479.39,185.45Zm1.8,26.59a8.86,8.86,0,0,0,4.84,1.35q7.58,0,10.87-5.1a12.73,12.73,0,0,0,2.14-4.73c.37-1.7.79-3.45,1.24-5.25h-.15a8.74,8.74,0,0,1-3.42,1.39c-1.37.27-2.83.49-4.38.64s-3.12.33-4.69.56A18.11,18.11,0,0,0,483.4,202a7.84,7.84,0,0,0-3.07,2.13,6,6,0,0,0-1.28,3.87A4.47,4.47,0,0,0,481.19,212Z" />
                    <path class="cls-1"
                      d="M536.65,179.34l-1.2,5.62h-7.72l-4.8,22.8c0,.45-.1.88-.15,1.28a10.18,10.18,0,0,0-.08,1.27,2.08,2.08,0,0,0,1.16,2.06,6,6,0,0,0,2.67.57,9.48,9.48,0,0,0,1.87-.19,17.19,17.19,0,0,0,1.8-.49l-1.12,5.85c-.75.1-1.5.19-2.25.26a21.2,21.2,0,0,1-2.25.12,20,20,0,0,1-3.38-.27,7.61,7.61,0,0,1-2.74-1,5.52,5.52,0,0,1-1.87-1.91,5.93,5.93,0,0,1-.71-3.08,9.92,9.92,0,0,1,.11-1.57c.07-.5.16-1.05.26-1.65l5.1-24.08h-6.52l1.2-5.62h6.52l2.4-11.48h6.38l-2.4,11.48Z" />
                    <path class="cls-1" d="M550.08,179.34,542,218.11h-6.3l8-38.77Zm-5-7,1.65-7.8h6.45l-1.65,7.8Z" />
                    <path class="cls-1"
                      d="M555.36,193.66a23.64,23.64,0,0,1,4.28-7.8,21.21,21.21,0,0,1,6.82-5.4,20,20,0,0,1,9.11-2q7.88,0,12,4.08t4.13,12a29.67,29.67,0,0,1-1.43,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.69,19.69,0,0,1-9.07,2,18.72,18.72,0,0,1-6.86-1.2A14.26,14.26,0,0,1,555,209.3a18.17,18.17,0,0,1-1.12-6.49A29.11,29.11,0,0,1,555.36,193.66Zm7.62,16.8q2.68,2.92,7.94,2.93a10.78,10.78,0,0,0,6.19-1.8,16.48,16.48,0,0,0,4.5-4.54,21.36,21.36,0,0,0,2.78-6,22,22,0,0,0,.93-6.08,15.3,15.3,0,0,0-.59-4.27,9.33,9.33,0,0,0-1.88-3.49,9.12,9.12,0,0,0-3.19-2.33,11,11,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8A16.35,16.35,0,0,0,564,190.4a20.61,20.61,0,0,0-2.81,6,23.25,23.25,0,0,0-.94,6.3A10.89,10.89,0,0,0,563,210.46Z" />
                    <path class="cls-1"
                      d="M609.62,179.34l-1.2,5.85h.15a15.14,15.14,0,0,1,6.08-5.07,18.35,18.35,0,0,1,7.72-1.68c3.65,0,6.37.8,8.14,2.4s2.66,4.12,2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.47,2.78-.82,4.28l-4.73,22.12H621l4.95-22.65c.05-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.27-1.65a10.28,10.28,0,0,0,.11-1.31,4.59,4.59,0,0,0-1.95-4.09,8.44,8.44,0,0,0-4.8-1.31,11.67,11.67,0,0,0-5.21,1.28,14.73,14.73,0,0,0-4.39,3.22,10.53,10.53,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l8.1-38.77Z" />
                    <path class="cls-1"
                      d="M643.34,185.45a14.06,14.06,0,0,1,3.78-3.94,15.83,15.83,0,0,1,5.1-2.32,23.22,23.22,0,0,1,5.93-.75,31.06,31.06,0,0,1,5.4.45,13.69,13.69,0,0,1,4.5,1.57,8.55,8.55,0,0,1,3.11,3,9.13,9.13,0,0,1,1.16,4.84,16.64,16.64,0,0,1-.41,3.56c-.27,1.27-.54,2.44-.79,3.49L668.65,206c-.15.8-.36,1.7-.64,2.7a11,11,0,0,0-.41,2.85,2.64,2.64,0,0,0,.52,1.88,1.82,1.82,0,0,0,1.35.52,3.18,3.18,0,0,0,1-.19l1-.33-1,4.72a12.18,12.18,0,0,1-1.91.56,9,9,0,0,1-2,.27,5.21,5.21,0,0,1-4-1.43,4.69,4.69,0,0,1-1-4l-.15-.15a13.38,13.38,0,0,1-5,4.12,18.69,18.69,0,0,1-7.95,1.43,17.86,17.86,0,0,1-4.61-.57,9.5,9.5,0,0,1-3.71-1.87,9.3,9.3,0,0,1-2.51-3.38,12.1,12.1,0,0,1-.94-5.06,10.71,10.71,0,0,1,1.84-6.67,11.53,11.53,0,0,1,4.68-3.64,23.14,23.14,0,0,1,6.3-1.69q3.45-.45,6.68-.75c1.7-.15,3.16-.31,4.39-.49a9.84,9.84,0,0,0,3-.86,3.84,3.84,0,0,0,1.77-1.72,7.06,7.06,0,0,0,.56-3.08,4.07,4.07,0,0,0-.75-2.55,5.43,5.43,0,0,0-1.88-1.54,8.78,8.78,0,0,0-2.51-.78,16.59,16.59,0,0,0-2.66-.23,17,17,0,0,0-3.56.38,10.28,10.28,0,0,0-3.19,1.23,8.35,8.35,0,0,0-2.4,2.18,7.14,7.14,0,0,0-1.28,3.19h-6.37A13.45,13.45,0,0,1,643.34,185.45Zm1.8,26.59a8.83,8.83,0,0,0,4.83,1.35q7.57,0,10.88-5.1a12.73,12.73,0,0,0,2.14-4.73q.56-2.55,1.23-5.25h-.15a8.69,8.69,0,0,1-3.41,1.39c-1.37.27-2.84.49-4.39.64s-3.11.33-4.68.56a18.11,18.11,0,0,0-4.24,1.09,7.88,7.88,0,0,0-3.08,2.13A6,6,0,0,0,643,208,4.47,4.47,0,0,0,645.14,212Z" />
                    <path class="cls-1" d="M693.55,164.56,682.3,218.11H676l11.17-53.55Z" />
                    <path class="cls-1"
                      d="M755.39,214.17q-5.89,5.15-15.79,5.14-11,0-17-6.11t-6-17.29a37.86,37.86,0,0,1,2-12.41,32.13,32.13,0,0,1,5.82-10.39,27.51,27.51,0,0,1,21.56-9.82,26.66,26.66,0,0,1,8.06,1.16,18.43,18.43,0,0,1,6.45,3.45,15.87,15.87,0,0,1,4.31,5.77,19.64,19.64,0,0,1,1.58,8.14h-7.13q0-6.3-3.71-9.41a14.34,14.34,0,0,0-9.56-3.11,19.47,19.47,0,0,0-9.79,2.36,22.07,22.07,0,0,0-6.94,6.11,26.89,26.89,0,0,0-4.16,8.51,34.16,34.16,0,0,0-1.39,9.64,24.58,24.58,0,0,0,1,7.13,15.14,15.14,0,0,0,2.92,5.51,13.23,13.23,0,0,0,4.92,3.56,17.62,17.62,0,0,0,7,1.28q6.6,0,10.72-3.49a19,19,0,0,0,5.85-9.86h7.13Q761.28,209,755.39,214.17Z" />
                    <path class="cls-1"
                      d="M775.07,204a9.33,9.33,0,0,0,.83,4,8.21,8.21,0,0,0,2.25,2.93,10.91,10.91,0,0,0,3.22,1.8,11.28,11.28,0,0,0,3.75.64,12.12,12.12,0,0,0,7-1.92A11.25,11.25,0,0,0,796.3,206h6.37a16.72,16.72,0,0,1-2.4,5.66,15.16,15.16,0,0,1-4,4,17.5,17.5,0,0,1-5.18,2.44,21.47,21.47,0,0,1-6,.83,19.1,19.1,0,0,1-8-1.47,13.82,13.82,0,0,1-5.06-3.75,13.45,13.45,0,0,1-2.62-5,20,20,0,0,1-.75-5.29,30.46,30.46,0,0,1,1.61-10.16,25.1,25.1,0,0,1,4.35-7.91,19.42,19.42,0,0,1,6.37-5.1,17,17,0,0,1,7.62-1.8q8.55,0,12.48,4.5t3.94,12.67a17.34,17.34,0,0,1-.22,2.85c-.15.9-.28,1.63-.38,2.18H775.3A24.88,24.88,0,0,0,775.07,204Zm23.36-13a9.17,9.17,0,0,0-1.5-3.53,7.9,7.9,0,0,0-2.88-2.47,9.45,9.45,0,0,0-4.43-.94,13.78,13.78,0,0,0-5,.86,12.5,12.5,0,0,0-3.86,2.37,14,14,0,0,0-2.77,3.48,20.71,20.71,0,0,0-1.8,4.24h22.5A14.2,14.2,0,0,0,798.43,191Z" />
                    <path class="cls-1"
                      d="M822.17,179.34l-1.2,5.85h.15a15.14,15.14,0,0,1,6.08-5.07,18.31,18.31,0,0,1,7.72-1.68q5.48,0,8.14,2.4t2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.48,2.78-.82,4.28l-4.73,22.12H833.5l5-22.65c0-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.26-1.65a8.91,8.91,0,0,0,.12-1.31,4.59,4.59,0,0,0-2-4.09,8.44,8.44,0,0,0-4.8-1.31,11.75,11.75,0,0,0-5.22,1.28,14.81,14.81,0,0,0-4.38,3.22,10.41,10.41,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l8.1-38.77Z" />
                    <path class="cls-1"
                      d="M874.22,179.34,873,185H865.3l-4.8,22.8c0,.45-.11.88-.15,1.28a10.18,10.18,0,0,0-.08,1.27,2.08,2.08,0,0,0,1.16,2.06,6,6,0,0,0,2.67.57,9.48,9.48,0,0,0,1.87-.19,17.19,17.19,0,0,0,1.8-.49l-1.12,5.85c-.75.1-1.5.19-2.25.26a21.2,21.2,0,0,1-2.25.12,20,20,0,0,1-3.38-.27,7.61,7.61,0,0,1-2.74-1,5.52,5.52,0,0,1-1.87-1.91,5.93,5.93,0,0,1-.71-3.08,9.92,9.92,0,0,1,.11-1.57c.07-.5.16-1.05.26-1.65l5.1-24.08H852.4l1.2-5.62h6.52l2.4-11.48h6.38l-2.4,11.48Z" />
                    <path class="cls-1"
                      d="M880.67,204a9.19,9.19,0,0,0,.83,4,8.21,8.21,0,0,0,2.25,2.93,10.79,10.79,0,0,0,3.22,1.8,11.28,11.28,0,0,0,3.75.64,12.12,12.12,0,0,0,7-1.92,11.17,11.17,0,0,0,4.12-5.51h6.38a16.72,16.72,0,0,1-2.4,5.66,15.2,15.2,0,0,1-4,4,17.33,17.33,0,0,1-5.17,2.44,21.47,21.47,0,0,1-6,.83,19.1,19.1,0,0,1-8-1.47,13.82,13.82,0,0,1-5.06-3.75,13.3,13.3,0,0,1-2.62-5,20,20,0,0,1-.75-5.29,30.46,30.46,0,0,1,1.61-10.16,25.1,25.1,0,0,1,4.35-7.91,19.42,19.42,0,0,1,6.37-5.1,17,17,0,0,1,7.62-1.8q8.55,0,12.48,4.5t3.94,12.67a17.34,17.34,0,0,1-.22,2.85c-.15.9-.28,1.63-.38,2.18H880.89A26.62,26.62,0,0,0,880.67,204ZM904,191a9.17,9.17,0,0,0-1.5-3.53,7.85,7.85,0,0,0-2.89-2.47,9.38,9.38,0,0,0-4.42-.94,13.78,13.78,0,0,0-5,.86,12.5,12.5,0,0,0-3.86,2.37,14,14,0,0,0-2.77,3.48,20.71,20.71,0,0,0-1.8,4.24h22.5A14.58,14.58,0,0,0,904,191Z" />
                    <path class="cls-1"
                      d="M927.54,179.34l-1.87,8.32h.15a21.18,21.18,0,0,1,5.74-6.6,13.49,13.49,0,0,1,8.36-2.62,7.87,7.87,0,0,0,1.12-.08,3,3,0,0,1,1.13.08l-1.5,6.82a4.6,4.6,0,0,0-1-.07h-.9c-.8,0-1.45,0-1.94,0a9.68,9.68,0,0,0-1.88.34,12.38,12.38,0,0,0-4.69,2.33,16.56,16.56,0,0,0-3.56,4,15.72,15.72,0,0,0-2,4.39c-.5,1.67-.9,3.24-1.2,4.69l-3.67,17.17h-6.3l8-38.77Z" />
                    <path class="cls-1"
                      d="M962,185l1.12-5.62h6.6c.5-2,1-3.85,1.39-5.7a18.7,18.7,0,0,1,1.84-4.92,9.43,9.43,0,0,1,3.34-3.45,11.43,11.43,0,0,1,6-1.31c.9,0,1.8,0,2.7.11a13.47,13.47,0,0,1,2.62.49l-1,5.4c-.55-.1-1.07-.19-1.57-.26a9,9,0,0,0-1.43-.11,6.35,6.35,0,0,0-3.6.86,5.82,5.82,0,0,0-2,2.25,11.28,11.28,0,0,0-1,3.11c-.23,1.15-.52,2.33-.87,3.53h7.43l-1,5.62h-7.5l-7.13,33.15h-6.37l7.2-33.15Z" />
                    <path class="cls-1"
                      d="M984.58,193.66a23.64,23.64,0,0,1,4.28-7.8,21.21,21.21,0,0,1,6.82-5.4,19.92,19.92,0,0,1,9.11-2q7.88,0,12,4.08t4.13,12a29.67,29.67,0,0,1-1.43,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.69,19.69,0,0,1-9.07,2,18.72,18.72,0,0,1-6.86-1.2,14.26,14.26,0,0,1-8.37-8.44,18.17,18.17,0,0,1-1.12-6.49A29.11,29.11,0,0,1,984.58,193.66Zm7.61,16.8q2.7,2.92,7.95,2.93a10.78,10.78,0,0,0,6.19-1.8,16.76,16.76,0,0,0,4.5-4.54,21.36,21.36,0,0,0,2.78-6,22,22,0,0,0,.93-6.08,14.94,14.94,0,0,0-.6-4.27,8.9,8.9,0,0,0-5.06-5.82,11,11,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.61,20.61,0,0,0-2.81,6,23.25,23.25,0,0,0-.94,6.3A10.93,10.93,0,0,0,992.19,210.46Z" />
                    <path class="cls-1"
                      d="M1038.62,179.34l-1.88,8.32h.15a21.18,21.18,0,0,1,5.74-6.6,13.49,13.49,0,0,1,8.36-2.62,8,8,0,0,0,1.13-.08,2.9,2.9,0,0,1,1.12.08l-1.5,6.82a4.49,4.49,0,0,0-1-.07h-.9q-1.2,0-1.95,0a9.82,9.82,0,0,0-1.88.34,12.38,12.38,0,0,0-4.69,2.33,16.56,16.56,0,0,0-3.56,4,15.71,15.71,0,0,0-2,4.39c-.5,1.67-.9,3.24-1.2,4.69l-3.68,17.17h-6.3l8-38.77Z" />
                    <path class="cls-1"
                      d="M1103.94,164.56q7.88,0,11.4,3.38t3.53,9.45a14.08,14.08,0,0,1-2.74,8.28,12.49,12.49,0,0,1-3.19,3,10.55,10.55,0,0,1-4.27,1.62v.15a10.83,10.83,0,0,1,5.85,3.93,11.59,11.59,0,0,1,2.17,7.17,15.94,15.94,0,0,1-1.46,6.9,15.23,15.23,0,0,1-4,5.21,19.06,19.06,0,0,1-6,3.3,23.21,23.21,0,0,1-7.42,1.16h-26.48l11.18-53.55Zm-7.35,47.55a31.91,31.91,0,0,0,3.53-.26,12.71,12.71,0,0,0,4.27-1.35,10.58,10.58,0,0,0,3.64-3.19,9.62,9.62,0,0,0,1.54-5.77,8.29,8.29,0,0,0-.9-4.13,6.12,6.12,0,0,0-2.44-2.4,10.84,10.84,0,0,0-3.53-1.12,27.79,27.79,0,0,0-4.16-.3h-15.3l-3.9,18.52Zm3.75-24.52q11.4,0,11.4-10.2a6.17,6.17,0,0,0-1-3.75,6.31,6.31,0,0,0-2.59-2,11.47,11.47,0,0,0-3.41-.86,33.17,33.17,0,0,0-3.49-.19H1088l-3.6,17Z" />
                    <path class="cls-1" d="M1136.19,179.34l-8.1,38.77h-6.3l8-38.77Zm-5-7,1.65-7.8h6.45l-1.65,7.8Z" />
                    <path class="cls-1"
                      d="M1141.48,193.66a23.62,23.62,0,0,1,4.27-7.8,21.24,21.24,0,0,1,6.83-5.4,19.92,19.92,0,0,1,9.11-2q7.88,0,12,4.08t4.12,12a29.66,29.66,0,0,1-1.42,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.74,19.74,0,0,1-9.08,2,18.76,18.76,0,0,1-6.86-1.2,14.21,14.21,0,0,1-8.36-8.44,18.17,18.17,0,0,1-1.12-6.49A28.83,28.83,0,0,1,1141.48,193.66Zm7.61,16.8q2.7,2.92,8,2.93a10.8,10.8,0,0,0,6.19-1.8,16.76,16.76,0,0,0,4.5-4.54,21.33,21.33,0,0,0,2.77-6,21.66,21.66,0,0,0,.94-6.08,14.94,14.94,0,0,0-.6-4.27,9,9,0,0,0-5.06-5.82,11.08,11.08,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.36,20.36,0,0,0-2.81,6,22.87,22.87,0,0,0-.94,6.3A10.93,10.93,0,0,0,1149.09,210.46Z" />
                    <path class="cls-1"
                      d="M1206.09,179.34l-1.2,5.62h-7.73l-4.8,22.8c0,.45-.1.88-.15,1.28a10.24,10.24,0,0,0-.07,1.27,2.07,2.07,0,0,0,1.16,2.06,6,6,0,0,0,2.66.57,9.59,9.59,0,0,0,1.88-.19,17.19,17.19,0,0,0,1.8-.49l-1.13,5.85c-.75.1-1.5.19-2.25.26a21.2,21.2,0,0,1-2.25.12,19.92,19.92,0,0,1-3.37-.27,7.61,7.61,0,0,1-2.74-1,5.52,5.52,0,0,1-1.87-1.91,5.93,5.93,0,0,1-.72-3.08,9.9,9.9,0,0,1,.12-1.57c.07-.5.16-1.05.26-1.65l5.1-24.08h-6.53l1.2-5.62H1192l2.4-11.48h6.37l-2.4,11.48Z" />
                    <path class="cls-1"
                      d="M1212.54,204a9.33,9.33,0,0,0,.82,4,8.21,8.21,0,0,0,2.25,2.93,11,11,0,0,0,3.23,1.8,11.28,11.28,0,0,0,3.75.64,12.12,12.12,0,0,0,7.05-1.92,11.23,11.23,0,0,0,4.12-5.51h6.38a16.72,16.72,0,0,1-2.4,5.66,15.2,15.2,0,0,1-4,4,17.44,17.44,0,0,1-5.17,2.44,21.47,21.47,0,0,1-6,.83,19.1,19.1,0,0,1-8-1.47,13.73,13.73,0,0,1-5.06-3.75,13.47,13.47,0,0,1-2.63-5,20,20,0,0,1-.75-5.29,30.71,30.71,0,0,1,1.61-10.16,25.31,25.31,0,0,1,4.36-7.91,19.32,19.32,0,0,1,6.37-5.1,16.93,16.93,0,0,1,7.61-1.8q8.55,0,12.49,4.5t3.94,12.67a17.32,17.32,0,0,1-.23,2.85c-.15.9-.27,1.63-.37,2.18h-29.18A24.88,24.88,0,0,0,1212.54,204Zm23.36-13a9.48,9.48,0,0,0-1.5-3.53,8,8,0,0,0-2.89-2.47,9.41,9.41,0,0,0-4.42-.94,13.74,13.74,0,0,0-5,.86,12.38,12.38,0,0,0-3.86,2.37,14.06,14.06,0,0,0-2.78,3.48,20.71,20.71,0,0,0-1.8,4.24h22.5A14.57,14.57,0,0,0,1235.9,191Z" />
                    <path class="cls-1"
                      d="M1274.71,186.05a8.54,8.54,0,0,0-6-2,12.6,12.6,0,0,0-6.49,1.65,15.46,15.46,0,0,0-4.72,4.28,19.2,19.2,0,0,0-2.89,5.88,22.39,22.39,0,0,0-1,6.42,18.44,18.44,0,0,0,.48,4.27,9.62,9.62,0,0,0,1.62,3.53,8,8,0,0,0,3,2.4,10.26,10.26,0,0,0,4.54.9,11.49,11.49,0,0,0,7-2.18,12.45,12.45,0,0,0,4.27-5.77h6.38a17.68,17.68,0,0,1-6.3,10.05,18.39,18.39,0,0,1-11.4,3.45q-8,0-12-4.35t-4-12.3a28.61,28.61,0,0,1,1.39-8.93,23.07,23.07,0,0,1,4.12-7.61,19.9,19.9,0,0,1,15.94-7.31q6.6,0,10.46,3.18t4.09,10h-6.37A7.19,7.19,0,0,0,1274.71,186.05Z" />
                    <path class="cls-1"
                      d="M1303.29,164.56,1298.71,185l.15.15a15.14,15.14,0,0,1,6.08-5.07,18.35,18.35,0,0,1,7.72-1.68q5.47,0,8.14,2.4t2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.47,2.78-.82,4.28l-4.73,22.12h-6.37l5-22.65c0-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.26-1.65a8.91,8.91,0,0,0,.12-1.31,4.59,4.59,0,0,0-1.95-4.09,8.44,8.44,0,0,0-4.8-1.31,11.75,11.75,0,0,0-5.22,1.28,14.81,14.81,0,0,0-4.38,3.22,10.53,10.53,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l11.25-53.55Z" />
                    <path class="cls-1"
                      d="M1341.61,179.34l-1.2,5.85h.15a15.14,15.14,0,0,1,6.08-5.07,18.35,18.35,0,0,1,7.72-1.68q5.48,0,8.14,2.4t2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.47,2.78-.82,4.28l-4.73,22.12h-6.37l5-22.65c0-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.26-1.65a8.91,8.91,0,0,0,.12-1.31,4.59,4.59,0,0,0-2-4.09,8.44,8.44,0,0,0-4.8-1.31,11.75,11.75,0,0,0-5.22,1.28,14.81,14.81,0,0,0-4.38,3.22,10.53,10.53,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l8.1-38.77Z" />
                    <path class="cls-1"
                      d="M1372.1,193.66a23.62,23.62,0,0,1,4.27-7.8,21.24,21.24,0,0,1,6.83-5.4,19.92,19.92,0,0,1,9.11-2q7.88,0,12,4.08t4.13,12a29.67,29.67,0,0,1-1.43,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.69,19.69,0,0,1-9.07,2,18.82,18.82,0,0,1-6.87-1.2,14.28,14.28,0,0,1-8.36-8.44,18.17,18.17,0,0,1-1.12-6.49A28.83,28.83,0,0,1,1372.1,193.66Zm7.61,16.8q2.7,2.92,8,2.93a10.8,10.8,0,0,0,6.19-1.8,16.76,16.76,0,0,0,4.5-4.54,21.33,21.33,0,0,0,2.77-6,21.66,21.66,0,0,0,.94-6.08,14.94,14.94,0,0,0-.6-4.27,8.9,8.9,0,0,0-5.06-5.82,11.08,11.08,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.36,20.36,0,0,0-2.81,6,22.87,22.87,0,0,0-.94,6.3A10.93,10.93,0,0,0,1379.71,210.46Z" />
                    <path class="cls-1" d="M1429.66,164.56l-11.25,53.55h-6.3l11.18-53.55Z" />
                    <path class="cls-1"
                      d="M1431.8,193.66a23.62,23.62,0,0,1,4.27-7.8,21.24,21.24,0,0,1,6.83-5.4,19.92,19.92,0,0,1,9.11-2q7.88,0,12,4.08t4.12,12a29.66,29.66,0,0,1-1.42,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.74,19.74,0,0,1-9.08,2,18.76,18.76,0,0,1-6.86-1.2,14.21,14.21,0,0,1-8.36-8.44,18.17,18.17,0,0,1-1.13-6.49A28.83,28.83,0,0,1,1431.8,193.66Zm7.61,16.8q2.7,2.92,7.95,2.93a10.8,10.8,0,0,0,6.19-1.8,16.76,16.76,0,0,0,4.5-4.54,21.33,21.33,0,0,0,2.77-6,21.66,21.66,0,0,0,.94-6.08,14.94,14.94,0,0,0-.6-4.27,9,9,0,0,0-5.06-5.82,11.08,11.08,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.36,20.36,0,0,0-2.81,6,22.87,22.87,0,0,0-.94,6.3A10.93,10.93,0,0,0,1439.41,210.46Z" />
                    <path class="cls-1"
                      d="M1505.11,218.22a42.28,42.28,0,0,1-1.58,4.77,16.38,16.38,0,0,1-6.9,8.32,21.65,21.65,0,0,1-10.72,2.48,23.88,23.88,0,0,1-5.74-.68,14.84,14.84,0,0,1-4.84-2.1,11.05,11.05,0,0,1-3.41-3.71,11.55,11.55,0,0,1-1.39-5.51h6.3a6.24,6.24,0,0,0,1,3.18,6.06,6.06,0,0,0,2.17,1.95,9.21,9.21,0,0,0,3,1,24,24,0,0,0,3.52.26,12.06,12.06,0,0,0,6-1.35,11.56,11.56,0,0,0,3.86-3.52,18.41,18.41,0,0,0,2.37-5c.57-1.88,1.11-3.76,1.61-5.66l-.15-.15a11.91,11.91,0,0,1-5.25,4.5,17.17,17.17,0,0,1-6.83,1.35,16,16,0,0,1-6.34-1.17,11.82,11.82,0,0,1-4.53-3.3,14.61,14.61,0,0,1-2.74-5.06,20.9,20.9,0,0,1-.94-6.45,27.41,27.41,0,0,1,1.39-8.55,25.65,25.65,0,0,1,4-7.69,20.83,20.83,0,0,1,6.33-5.55,16.87,16.87,0,0,1,8.48-2.13,15,15,0,0,1,4.16.56,15.29,15.29,0,0,1,3.68,1.57,10.67,10.67,0,0,1,2.85,2.48,8.52,8.52,0,0,1,1.61,3.26v.15h.15l1.2-7.12h6l-7,33.15Q1505.86,215.49,1505.11,218.22Zm-24.45-11.88a9.87,9.87,0,0,0,1.76,3.3,8.36,8.36,0,0,0,3,2.28,9.55,9.55,0,0,0,4.2.87,11,11,0,0,0,6.27-1.8,15.09,15.09,0,0,0,4.38-4.58,22.14,22.14,0,0,0,2.59-6,24.36,24.36,0,0,0,.86-6.18,10.75,10.75,0,0,0-2.43-7.35q-2.45-2.78-7.47-2.78a9.72,9.72,0,0,0-5.92,1.88,16.68,16.68,0,0,0-4.28,4.61,22.49,22.49,0,0,0-2.62,5.92,21.83,21.83,0,0,0-.9,5.89A13,13,0,0,0,1480.66,206.34Z" />
                    <path class="cls-1"
                      d="M1525,228.2a16.49,16.49,0,0,1-2.62,2.92,10.93,10.93,0,0,1-3.23,1.95,11.26,11.26,0,0,1-4.2.72,10.54,10.54,0,0,1-2.32-.27,8.76,8.76,0,0,1-2.1-.71l1.12-5.17a7.5,7.5,0,0,0,1.8.75,7.15,7.15,0,0,0,1.8.3,5.2,5.2,0,0,0,3.53-1.17,12.37,12.37,0,0,0,2.47-3l3.9-6.38-6.82-38.77h6.82l4.5,30.82h.15l16.28-30.82h7l-25.65,45.3C1526.58,225.89,1525.78,227.07,1525,228.2Z" />
                    <path class="cls-1" d="M1591,164.56l-11.25,53.55h-7.12l11.25-53.55Z" />
                    <path class="cls-1"
                      d="M1605.45,179.34l-1.2,5.85h.15a15.14,15.14,0,0,1,6.08-5.07,18.35,18.35,0,0,1,7.72-1.68c3.65,0,6.37.8,8.14,2.4s2.66,4.12,2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.47,2.78-.82,4.28l-4.73,22.12h-6.37l5-22.65c0-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.27-1.65a10.28,10.28,0,0,0,.11-1.31,4.59,4.59,0,0,0-2-4.09,8.44,8.44,0,0,0-4.8-1.31,11.67,11.67,0,0,0-5.21,1.28,14.73,14.73,0,0,0-4.39,3.22,10.53,10.53,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l8.1-38.77Z" />
                    <path class="cls-1"
                      d="M1635.53,185l1.12-5.62h6.6c.5-2,1-3.85,1.39-5.7a18.7,18.7,0,0,1,1.84-4.92,9.43,9.43,0,0,1,3.34-3.45,11.43,11.43,0,0,1,6-1.31c.9,0,1.8,0,2.7.11a13.47,13.47,0,0,1,2.62.49l-1,5.4c-.55-.1-1.07-.19-1.57-.26a9,9,0,0,0-1.43-.11,6.35,6.35,0,0,0-3.6.86,5.82,5.82,0,0,0-2,2.25,11.28,11.28,0,0,0-1,3.11c-.23,1.15-.52,2.33-.87,3.53H1657l-1,5.62h-7.5l-7.13,33.15h-6.37l7.2-33.15Z" />
                    <path class="cls-1"
                      d="M1658.14,193.66a23.64,23.64,0,0,1,4.28-7.8,21.21,21.21,0,0,1,6.82-5.4,20,20,0,0,1,9.11-2q7.88,0,12,4.08t4.13,12a29.67,29.67,0,0,1-1.43,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.69,19.69,0,0,1-9.07,2,18.72,18.72,0,0,1-6.86-1.2,14.26,14.26,0,0,1-8.37-8.44,18.17,18.17,0,0,1-1.12-6.49A29.11,29.11,0,0,1,1658.14,193.66Zm7.61,16.8q2.7,2.92,8,2.93a10.78,10.78,0,0,0,6.19-1.8,16.48,16.48,0,0,0,4.5-4.54,21.36,21.36,0,0,0,2.78-6,22,22,0,0,0,.93-6.08,14.94,14.94,0,0,0-.6-4.27,8.9,8.9,0,0,0-5.06-5.82,11,11,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.61,20.61,0,0,0-2.81,6,23.25,23.25,0,0,0-.94,6.3A10.93,10.93,0,0,0,1665.75,210.46Z" />
                    <path class="cls-1"
                      d="M1712.18,179.34l-1.88,8.32h.15a21.18,21.18,0,0,1,5.74-6.6,13.51,13.51,0,0,1,8.36-2.62,8,8,0,0,0,1.13-.08,2.9,2.9,0,0,1,1.12.08l-1.5,6.82a4.49,4.49,0,0,0-1-.07h-.9q-1.2,0-2,0a9.82,9.82,0,0,0-1.88.34,12.27,12.27,0,0,0-4.68,2.33,16.39,16.39,0,0,0-3.57,4,15.71,15.71,0,0,0-2,4.39c-.5,1.67-.9,3.24-1.2,4.69l-3.68,17.17h-6.3l8-38.77Z" />
                    <path class="cls-1"
                      d="M1737.23,179.34l-1.43,5.77.15.15a18.56,18.56,0,0,1,6-5,16,16,0,0,1,7.54-1.83,12,12,0,0,1,6.3,1.57,7.83,7.83,0,0,1,3.45,5.4,16.69,16.69,0,0,1,5.82-5.06,15.48,15.48,0,0,1,7.46-1.91,16.53,16.53,0,0,1,4,.48,11.55,11.55,0,0,1,3.49,1.5,7.46,7.46,0,0,1,2.44,2.67,8.36,8.36,0,0,1,.9,4,23.25,23.25,0,0,1-.38,3.9c-.25,1.45-.5,2.72-.75,3.82l-4.87,23.25h-6.38l5.4-24.6a21.64,21.64,0,0,0,.41-2.14,13.51,13.51,0,0,0,.19-2.06,4.8,4.8,0,0,0-1.69-3.75,6.11,6.11,0,0,0-4.23-1.5,8.83,8.83,0,0,0-2.74.45,15,15,0,0,0-2.66,1.16,15,15,0,0,0-4.35,3.72,11,11,0,0,0-2.33,4,43.53,43.53,0,0,0-1.27,4.73l-4.28,20H1747l4.65-22.12c.35-1.5.64-2.9.86-4.2a20.19,20.19,0,0,0,.34-2.63,5,5,0,0,0-1.39-3.75,5.53,5.53,0,0,0-4-1.35,10.34,10.34,0,0,0-5.22,1.5,17.3,17.3,0,0,0-4.31,3.45,10.93,10.93,0,0,0-2.77,3.94,33.21,33.21,0,0,0-1.35,4.84l-4.35,20.32h-6.3l8.17-38.77Z" />
                    <path class="cls-1"
                      d="M1793.29,185.45a14.1,14.1,0,0,1,3.79-3.94,15.83,15.83,0,0,1,5.1-2.32,23.15,23.15,0,0,1,5.92-.75,31.06,31.06,0,0,1,5.4.45,13.69,13.69,0,0,1,4.5,1.57,8.55,8.55,0,0,1,3.11,3,9.13,9.13,0,0,1,1.17,4.84,16.68,16.68,0,0,1-.42,3.56c-.27,1.27-.53,2.44-.78,3.49L1818.6,206c-.15.8-.36,1.7-.64,2.7a11,11,0,0,0-.41,2.85,2.64,2.64,0,0,0,.53,1.88,1.82,1.82,0,0,0,1.35.52,3.12,3.12,0,0,0,1-.19l1-.33-1,4.72a12.34,12.34,0,0,1-1.92.56,8.91,8.91,0,0,1-2,.27,5.23,5.23,0,0,1-4-1.43,4.69,4.69,0,0,1-1-4l-.15-.15a13.35,13.35,0,0,1-5,4.12,18.69,18.69,0,0,1-8,1.43,17.94,17.94,0,0,1-4.62-.57,9.5,9.5,0,0,1-3.71-1.87,9.3,9.3,0,0,1-2.51-3.38,12.1,12.1,0,0,1-.94-5.06,10.71,10.71,0,0,1,1.84-6.67,11.57,11.57,0,0,1,4.69-3.64,23.14,23.14,0,0,1,6.3-1.69q3.45-.45,6.67-.75c1.7-.15,3.16-.31,4.39-.49a9.91,9.91,0,0,0,3-.86,3.81,3.81,0,0,0,1.76-1.72,7.06,7.06,0,0,0,.56-3.08,4.07,4.07,0,0,0-.75-2.55,5.39,5.39,0,0,0-1.87-1.54,8.85,8.85,0,0,0-2.52-.78,16.59,16.59,0,0,0-2.66-.23,17,17,0,0,0-3.56.38,10.28,10.28,0,0,0-3.19,1.23,8.35,8.35,0,0,0-2.4,2.18,7.13,7.13,0,0,0-1.27,3.19h-6.38A13.45,13.45,0,0,1,1793.29,185.45Zm1.8,26.59a8.86,8.86,0,0,0,4.84,1.35q7.58,0,10.87-5.1a12.73,12.73,0,0,0,2.14-4.73c.37-1.7.79-3.45,1.24-5.25H1814a8.74,8.74,0,0,1-3.42,1.39c-1.37.27-2.83.49-4.38.64s-3.12.33-4.69.56a18.11,18.11,0,0,0-4.24,1.09,7.84,7.84,0,0,0-3.07,2.13A6,6,0,0,0,1793,208,4.47,4.47,0,0,0,1795.09,212Z" />
                    <path class="cls-1"
                      d="M1850.55,179.34l-1.2,5.62h-7.72l-4.8,22.8c0,.45-.1.88-.15,1.28a10.18,10.18,0,0,0-.08,1.27,2.08,2.08,0,0,0,1.16,2.06,6,6,0,0,0,2.67.57,9.48,9.48,0,0,0,1.87-.19,17.19,17.19,0,0,0,1.8-.49l-1.12,5.85c-.75.1-1.5.19-2.25.26a21.2,21.2,0,0,1-2.25.12,20,20,0,0,1-3.38-.27,7.61,7.61,0,0,1-2.74-1,5.52,5.52,0,0,1-1.87-1.91,5.93,5.93,0,0,1-.71-3.08,9.92,9.92,0,0,1,.11-1.57c.07-.5.16-1.05.26-1.65l5.1-24.08h-6.52l1.2-5.62h6.52l2.4-11.48h6.38l-2.4,11.48Z" />
                    <path class="cls-1" d="M1864,179.34l-8.1,38.77h-6.3l8-38.77Zm-5-7,1.65-7.8h6.45l-1.65,7.8Z" />
                    <path class="cls-1"
                      d="M1869.26,193.66a23.64,23.64,0,0,1,4.28-7.8,21.21,21.21,0,0,1,6.82-5.4,20,20,0,0,1,9.11-2q7.88,0,12,4.08t4.13,12a29.67,29.67,0,0,1-1.43,9.15,23.82,23.82,0,0,1-4.2,7.83,20.66,20.66,0,0,1-6.75,5.44,19.69,19.69,0,0,1-9.07,2,18.72,18.72,0,0,1-6.86-1.2,14.26,14.26,0,0,1-8.37-8.44,18.17,18.17,0,0,1-1.12-6.49A29.11,29.11,0,0,1,1869.26,193.66Zm7.61,16.8q2.7,2.92,8,2.93a10.78,10.78,0,0,0,6.19-1.8,16.48,16.48,0,0,0,4.5-4.54,21.36,21.36,0,0,0,2.78-6,22,22,0,0,0,.93-6.08,14.94,14.94,0,0,0-.6-4.27,8.9,8.9,0,0,0-5.06-5.82,11,11,0,0,0-4.54-.86,11.59,11.59,0,0,0-6.45,1.8,16.35,16.35,0,0,0-4.65,4.54,20.61,20.61,0,0,0-2.81,6,23.25,23.25,0,0,0-.94,6.3A10.93,10.93,0,0,0,1876.87,210.46Z" />
                    <path class="cls-1"
                      d="M1923.52,179.34l-1.2,5.85h.15a15.14,15.14,0,0,1,6.08-5.07,18.35,18.35,0,0,1,7.72-1.68c3.65,0,6.37.8,8.14,2.4s2.66,4.12,2.66,7.57a23.49,23.49,0,0,1-.3,3.3c-.2,1.35-.47,2.78-.82,4.28l-4.73,22.12h-6.37l5-22.65c0-.4.12-.86.22-1.39s.2-1.07.3-1.65.19-1.12.27-1.65a10.28,10.28,0,0,0,.11-1.31,4.59,4.59,0,0,0-2-4.09,8.44,8.44,0,0,0-4.8-1.31,11.75,11.75,0,0,0-5.22,1.28,14.81,14.81,0,0,0-4.38,3.22,10.53,10.53,0,0,0-2.7,3.64,26.79,26.79,0,0,0-1.58,4.46l-4.5,21.45h-6.3l8.1-38.77Z" />
                  </g>
                </g>
              </svg>
            </a>
        </div>
        </div>
    </div>
</header>

<main id="main_content">
  <div class="grid-container">
    <h1 aria-label="400 Error">400</h1>
    <h2>bad request</h2>
    <p class="margin-bottom-3 mobile:margin-bottom-6">Sorry, something went wrong. Please try again later.</p>
    <p>Try one of these options instead:</p>
    <div class="margin-bottom-3 mobile:margin-bottom-6">
      <ul class="usa-list usa-list--unstyled flex-wrapper display-block tablet:display-flex">
        <li class="flex-child"><button class="usa-button" id="ncbiHomeBtn">NCBI Home</button></li>
        <li class="flex-child"><button class="usa-button" id="helpDeskBtn">Contact Help Desk</button></li>
        <li class="flex-child flex-fill">
          <form class="usa-search" role="search" method="get" action="https://www.ncbi.nlm.nih.gov/search/all">
            <input class="usa-input" id="basic-search-field-medium" type="search" name="term" placeholder="Search NCBI" aria-label="Search NCBI">
            <button class="usa-button usa-button__reset" type="reset"></button>
            <button class="usa-button usa-button__search" type="submit" aria-label="Search" data-section="link_click" data-ga-action="search_ncbi" data-ga-label="NONE">
              <span aria-hidden="true">Search</span>
            </button>
          </form>
        </li>
      </ul>
    </div>
  </div>
</main>

<footer>
  <section class="icon-section">
    <div id="icon-section-header" class="icon-section_header">Follow NCBI</div>
    <div class="grid-container container">
      <div class="icon-section_container">
        <a class="footer-icon" id="footer_twitter" href="https://twitter.com/ncbi" aria-label="Twitter"><svg
            data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" viewBox="0 0 300 300">
            <defs>
              <style>
                .cls-11 {
                  fill: #737373;
                }
              </style>
            </defs>
            <title>Twitter</title>
            <path class="cls-11"
              d="M250.11,105.48c-7,3.14-13,3.25-19.27.14,8.12-4.86,8.49-8.27,11.43-17.46a78.8,78.8,0,0,1-25,9.55,39.35,39.35,0,0,0-67,35.85,111.6,111.6,0,0,1-81-41.08A39.37,39.37,0,0,0,81.47,145a39.08,39.08,0,0,1-17.8-4.92c0,.17,0,.33,0,.5a39.32,39.32,0,0,0,31.53,38.54,39.26,39.26,0,0,1-17.75.68,39.37,39.37,0,0,0,36.72,27.3A79.07,79.07,0,0,1,56,223.34,111.31,111.31,0,0,0,116.22,241c72.3,0,111.83-59.9,111.83-111.84,0-1.71,0-3.4-.1-5.09C235.62,118.54,244.84,113.37,250.11,105.48Z">
            </path>
          </svg></a>
        <a class="footer-icon" id="footer_facebook" href="https://www.facebook.com/ncbi.nlm" aria-label="Facebook"><svg
            data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" viewBox="0 0 300 300">
            <title>Facebook</title>
            <path class="cls-11"
              d="M210.5,115.12H171.74V97.82c0-8.14,5.39-10,9.19-10h27.14V52l-39.32-.12c-35.66,0-42.42,26.68-42.42,43.77v19.48H99.09v36.32h27.24v109h45.41v-109h35Z">
            </path>
          </svg></a>
        <a class="footer-icon" id="footer_linkedin"
          href="https://www.linkedin.com/company/ncbinlm"
          aria-label="LinkedIn"><svg data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" viewBox="0 0 300 300">
            <title>LinkedIn</title>
            <path class="cls-11"
              d="M101.64,243.37H57.79v-114h43.85Zm-22-131.54h-.26c-13.25,0-21.82-10.36-21.82-21.76,0-11.65,8.84-21.15,22.33-21.15S101.7,78.72,102,90.38C102,101.77,93.4,111.83,79.63,111.83Zm100.93,52.61A17.54,17.54,0,0,0,163,182v61.39H119.18s.51-105.23,0-114H163v13a54.33,54.33,0,0,1,34.54-12.66c26,0,44.39,18.8,44.39,55.29v58.35H198.1V182A17.54,17.54,0,0,0,180.56,164.44Z">
            </path>
          </svg></a>
        <a class="footer-icon" id="footer_github" href="https://github.com/ncbi" aria-label="GitHub"><svg
            data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" viewBox="0 0 300 300">
            <defs>
              <style>
                .cls-11,
                .cls-12 {
                  fill: #737373;
                }

                .cls-11 {
                  fill-rule: evenodd;
                }
              </style>
            </defs>
            <title>GitHub</title>
            <path class="cls-11"
              d="M151.36,47.28a105.76,105.76,0,0,0-33.43,206.1c5.28,1,7.22-2.3,7.22-5.09,0-2.52-.09-10.85-.14-19.69-29.42,6.4-35.63-12.48-35.63-12.48-4.81-12.22-11.74-15.47-11.74-15.47-9.59-6.56.73-6.43.73-6.43,10.61.75,16.21,10.9,16.21,10.9,9.43,16.17,24.73,11.49,30.77,8.79,1-6.83,3.69-11.5,6.71-14.14C108.57,197.1,83.88,188,83.88,147.51a40.92,40.92,0,0,1,10.9-28.39c-1.1-2.66-4.72-13.42,1-28,0,0,8.88-2.84,29.09,10.84a100.26,100.26,0,0,1,53,0C198,88.3,206.9,91.14,206.9,91.14c5.76,14.56,2.14,25.32,1,28a40.87,40.87,0,0,1,10.89,28.39c0,40.62-24.74,49.56-48.29,52.18,3.79,3.28,7.17,9.71,7.17,19.58,0,14.15-.12,25.54-.12,29,0,2.82,1.9,6.11,7.26,5.07A105.76,105.76,0,0,0,151.36,47.28Z">
            </path>
            <path class="cls-12"
              d="M85.66,199.12c-.23.52-1.06.68-1.81.32s-1.2-1.06-.95-1.59,1.06-.69,1.82-.33,1.21,1.07.94,1.6Zm-1.3-1">
            </path>
            <path class="cls-12"
              d="M90,203.89c-.51.47-1.49.25-2.16-.49a1.61,1.61,0,0,1-.31-2.19c.52-.47,1.47-.25,2.17.49s.82,1.72.3,2.19Zm-1-1.08">
            </path>
            <path class="cls-12"
              d="M94.12,210c-.65.46-1.71,0-2.37-.91s-.64-2.07,0-2.52,1.7,0,2.36.89.65,2.08,0,2.54Zm0,0"></path>
            <path class="cls-12"
              d="M99.83,215.87c-.58.64-1.82.47-2.72-.41s-1.18-2.06-.6-2.7,1.83-.46,2.74.41,1.2,2.07.58,2.7Zm0,0">
            </path>
            <path class="cls-12"
              d="M107.71,219.29c-.26.82-1.45,1.2-2.64.85s-2-1.34-1.74-2.17,1.44-1.23,2.65-.85,2,1.32,1.73,2.17Zm0,0">
            </path>
            <path class="cls-12"
              d="M116.36,219.92c0,.87-1,1.59-2.24,1.61s-2.29-.68-2.3-1.54,1-1.59,2.26-1.61,2.28.67,2.28,1.54Zm0,0">
            </path>
            <path class="cls-12"
              d="M124.42,218.55c.15.85-.73,1.72-2,1.95s-2.37-.3-2.52-1.14.73-1.75,2-2,2.37.29,2.53,1.16Zm0,0"></path>
          </svg></a>
        <a class="footer-icon" id="footer_blog" href="https://ncbiinsights.ncbi.nlm.nih.gov/" aria-label="Blog">
          <svg id="Layer_1" data-name="Layer 1" xmlns="http://www.w3.org/2000/svg" viewBox="0 0 40 40"><defs><style>.cls-13{fill:#737373;}</style></defs><path class="cls-13" d="M14,30a4,4,0,1,1-4-4,4,4,0,0,1,4,4Zm11,3A19,19,0,0,0,7.05,15a1,1,0,0,0-1,1v3a1,1,0,0,0,.93,1A14,14,0,0,1,20,33.07,1,1,0,0,0,21,34h3a1,1,0,0,0,1-1Zm9,0A28,28,0,0,0,7,6,1,1,0,0,0,6,7v3a1,1,0,0,0,1,1A23,23,0,0,1,29,33a1,1,0,0,0,1,1h3A1,1,0,0,0,34,33Z"/></svg>
        </a>
      </div>
    </div>
  </section>

  <section class="container-fluid bg-primary">
    <div class="container pt-5">
      <div class="row mt-3">
        <div class="col-lg-3 col-12">
          <p><a class="text-white" href="https://www.nlm.nih.gov/socialmedia/index.html">Connect with NLM</a></p>
          <ul class="list-inline social_media">
            <li class="list-inline-item"><a href="https://twitter.com/NLM_NIH" aria-label="Twitter"
                target="_blank" rel="noopener noreferrer"><svg version="1.1" xmlns="http://www.w3.org/2000/svg"
                  xmlns:xlink="http://www.w3.org/1999/xlink" x="0px" y="0px" viewBox="0 0 249 249"
                  style="enable-background:new 0 0 249 249;" xml:space="preserve">
                  <style type="text/css">
                    .st20 {
                      fill: #FFFFFF;
                    }

                    .st30 {
                      fill: none;
                      stroke: #FFFFFF;
                      stroke-width: 8;
                      stroke-miterlimit: 10;
                    }
                  </style>
                  <title>SM-Twitter</title>
                  <g>
                    <g>
                      <g>
                        <path class="st20" d="M192.9,88.1c-5,2.2-9.2,2.3-13.6,0.1c5.7-3.4,6-5.8,8.1-12.3c-5.4,3.2-11.4,5.5-17.6,6.7
                                            c-10.5-11.2-28.1-11.7-39.2-1.2c-7.2,6.8-10.2,16.9-8,26.5c-22.3-1.1-43.1-11.7-57.2-29C58,91.6,61.8,107.9,74,116
                                            c-4.4-0.1-8.7-1.3-12.6-3.4c0,0.1,0,0.2,0,0.4c0,13.2,9.3,24.6,22.3,27.2c-4.1,1.1-8.4,1.3-12.5,0.5c3.6,11.3,14,19,25.9,19.3
                                            c-11.6,9.1-26.4,13.2-41.1,11.5c12.7,8.1,27.4,12.5,42.5,12.5c51,0,78.9-42.2,78.9-78.9c0-1.2,0-2.4-0.1-3.6
                                            C182.7,97.4,189.2,93.7,192.9,88.1z"></path>
                      </g>
                    </g>
                    <circle class="st30" cx="124.4" cy="128.8" r="108.2"></circle>
                  </g>
                </svg></a></li>
            <li class="list-inline-item"><a href="https://www.facebook.com/nationallibraryofmedicine"
                aria-label="Facebook" rel="noopener noreferrer" target="_blank">
                <svg version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink" x="0px"
                  y="0px" viewBox="0 0 249 249" style="enable-background:new 0 0 249 249;" xml:space="preserve">
                  <style type="text/css">
                    .st10 {
                      fill: #FFFFFF;
                    }

                    .st110 {
                      fill: none;
                      stroke: #FFFFFF;
                      stroke-width: 8;
                      stroke-miterlimit: 10;
                    }
                  </style>
                  <title>SM-Facebook</title>
                  <g>
                    <g>
                      <path class="st10" d="M159,99.1h-24V88.4c0-5,3.3-6.2,5.7-6.2h16.8V60l-24.4-0.1c-22.1,0-26.2,16.5-26.2,27.1v12.1H90v22.5h16.9
                                                  v67.5H135v-67.5h21.7L159,99.1z"></path>
                    </g>
                  </g>
                  <circle class="st110" cx="123.6" cy="123.2" r="108.2"></circle>
                </svg>
              </a></li>
            <li class="list-inline-item"><a href="https://www.youtube.com/user/NLMNIH" aria-label="Youtube"
                target="_blank" rel="noopener noreferrer"><svg version="1.1" xmlns="http://www.w3.org/2000/svg"
                  xmlns:xlink="http://www.w3.org/1999/xlink" x="0px" y="0px" viewBox="0 0 249 249"
                  style="enable-background:new 0 0 249 249;" xml:space="preserve">
                  <title>SM-Youtube</title>
                  <style type="text/css">
                    .st4 {
                      fill: none;
                      stroke: #FFFFFF;
                      stroke-width: 8;
                      stroke-miterlimit: 10;
                    }

                    .st5 {
                      fill: #FFFFFF;
                    }
                  </style>
                  <circle class="st4" cx="124.2" cy="123.4" r="108.2"></circle>
                  <g transform="translate(0,-952.36218)">
                    <path class="st5"
                      d="M88.4,1037.4c-10.4,0-18.7,8.3-18.7,18.7v40.1c0,10.4,8.3,18.7,18.7,18.7h72.1c10.4,0,18.7-8.3,18.7-18.7
                                        v-40.1c0-10.4-8.3-18.7-18.7-18.7H88.4z M115.2,1058.8l29.4,17.4l-29.4,17.4V1058.8z"></path>
                  </g>
                </svg></a></li>
          </ul>
        </div>
        <div class="col-lg-3 col-12">
          <p class="address_footer text-white">National Library of Medicine<br>
            <a href="https://www.google.com/maps/place/8600+Rockville+Pike,+Bethesda,+MD+20894/@38.9959508,-77.101021,17z/data=!3m1!4b1!4m5!3m4!1s0x89b7c95e25765ddb:0x19156f88b27635b8!8m2!3d38.9959508!4d-77.0988323"
              class="text-white" target="_blank" rel="noopener noreferrer">8600 Rockville Pike<br>
              Bethesda, MD 20894</a></p>
        </div>
        <div class="col-lg-3 col-12 centered-lg">
          <p><a href="https://www.nlm.nih.gov/web_policies.html" class="text-white">Web Policies</a><br>
            <a href="https://www.nih.gov/institutes-nih/nih-office-director/office-communications-public-liaison/freedom-information-act-office"
              class="text-white">FOIA</a><br>
            <a href="https://www.hhs.gov/vulnerability-disclosure-policy/index.html" class="text-white" id="vdp">HHS Vulnerability Disclosure</a></p>
        </div>
        <div class="col-lg-3 col-12 centered-lg">
          <p><a class="supportLink text-white" href="https://support.nlm.nih.gov/">Help</a><br>
            <a href="https://www.nlm.nih.gov/accessibility.html" class="text-white">Accessibility</a><br>
            <a href="https://www.nlm.nih.gov/careers/careers.html" class="text-white">Careers</a></p>
        </div>
      </div>
      <div class="row">
        <div class="col-lg-12 centered-lg">
          <nav class="bottom-links">
            <ul class="mt-3">
              <li>
                <a class="text-white" href="//www.nlm.nih.gov/">NLM</a>
              </li>
              <li>
                <a class="text-white"
              href="https://www.nih.gov/">NIH</a>
              </li>
              <li>
                <a class="text-white" href="https://www.hhs.gov/">HHS</a>
              </li>
              <li>
                <a
              class="text-white" href="https://www.usa.gov/">USA.gov</a>
              </li>
            </ul>
          </nav>
        </div>
      </div>
    </div>
  </section>
</footer>

</body>
<script>
  const userEvents =  ['click', 'keypress'];
  for (let i = 0; i < userEvents.length; i++) {
    let evt = userEvents[i];
    document.querySelector('#icon-section-header').addEventListener(evt, function(e){
      if (document.body.clientWidth < 993) {
        classToggle(e.target);
      }
    });
  }
  function classToggle(elm) {
    elm.classList.toggle('opened');
  }
  let helpDeskBtn = document.querySelector('#helpDeskBtn');
  if (!!helpDeskBtn) {
    let helpDeskLink = 'https://support.nlm.nih.gov/support/create-case?from=' + encodeURIComponent(window.location.href);
    helpDeskBtn.addEventListener('click',  function(){
      window.open(helpDeskLink, '_blank')
    });
  }
  let ncbiHomeBtn = document.querySelector('#ncbiHomeBtn');
  if (!!ncbiHomeBtn) {
    ncbiHomeBtn.addEventListener('click', function(){
      window.open('https://www.ncbi.nlm.nih.gov', '_blank')
    });
  }
  // Following JavaScript is to toggle top banner of page.
  var head_bnr = document.querySelector(".usa-banner header.usa-banner-header");
  var btn_bnr = document.querySelector(".usa-banner button.usa-accordion-button.usa-banner-button");
  var acr_bnr = document.querySelector(".usa-banner div.usa-banner-content.usa-accordion-content");
  btn_bnr.addEventListener("click", function(e) {
    head_bnr.classList.toggle("usa-banner-header-expanded");
    var aria_val = this.getAttribute("aria-expanded");
    var opp_aria_val = (aria_val === "false") ? "true" : "false";
    this.setAttribute("aria-expanded", opp_aria_val);
    acr_bnr.setAttribute("aria-hidden", aria_val);
    e.stopPropagation();
  });
</script>
</html>

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.