Viewing data for Varecia variegata


Scientific name Varecia variegata
Common name Ruffed lemur
Maximum lifespan 37.00 years (Varecia variegata@AnAge)

Total mtDNA (size: 16965 bases) GC AT G C A T
Base content (bases) 6456 10509 4380 2076 4865 5644
Base content per 1 kb (bases) 381 619 258 122 287 333
Base content (%) 38.1% 61.9%
Total protein-coding genes (size: 11339 bases) GC AT G C A T
Base content (bases) 4326 7013 3080 1246 3384 3629
Base content per 1 kb (bases) 382 618 272 110 298 320
Base content (%) 38.2% 61.8%
D-loop (size: 1490 bases) GC AT G C A T
Base content (bases) 574 916 377 197 426 490
Base content per 1 kb (bases) 385 615 253 132 286 329
Base content (%) 38.5% 61.5%
Total tRNA-coding genes (size: 1517 bases) GC AT G C A T
Base content (bases) 545 972 328 217 425 547
Base content per 1 kb (bases) 359 641 216 143 280 361
Base content (%) 35.9% 64.1%
Total rRNA-coding genes (size: 2536 bases) GC AT G C A T
Base content (bases) 970 1566 566 404 607 959
Base content per 1 kb (bases) 382 618 223 159 239 378
Base content (%) 38.2% 61.8%
12S rRNA gene (size: 957 bases) GC AT G C A T
Base content (bases) 378 579 221 157 222 357
Base content per 1 kb (bases) 395 605 231 164 232 373
Base content (%) 39.5% 60.5%
16S rRNA gene (size: 1579 bases) GC AT G C A T
Base content (bases) 592 987 345 247 385 602
Base content per 1 kb (bases) 375 625 218 156 244 381
Base content (%) 37.5% 62.5%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 252 429 186 66 218 211
Base content per 1 kb (bases) 370 630 273 97 320 310
Base content (%) 37.0% 63.0%
ATP8 (size: 207 bases) GC AT G C A T
Base content (bases) 68 139 54 14 63 76
Base content per 1 kb (bases) 329 671 261 68 304 367
Base content (%) 32.9% 67.1%
COX1 (size: 1542 bases) GC AT G C A T
Base content (bases) 618 924 376 242 491 433
Base content per 1 kb (bases) 401 599 244 157 318 281
Base content (%) 40.1% 59.9%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 265 419 177 88 198 221
Base content per 1 kb (bases) 387 613 259 129 289 323
Base content (%) 38.7% 61.3%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 332 452 222 110 244 208
Base content per 1 kb (bases) 423 577 283 140 311 265
Base content (%) 42.3% 57.7%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 476 664 337 139 330 334
Base content per 1 kb (bases) 418 582 296 122 289 293
Base content (%) 41.8% 58.2%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 379 578 273 106 285 293
Base content per 1 kb (bases) 396 604 285 111 298 306
Base content (%) 39.6% 60.4%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 368 676 284 84 309 367
Base content per 1 kb (bases) 352 648 272 80 296 352
Base content (%) 35.2% 64.8%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 131 217 96 35 102 115
Base content per 1 kb (bases) 376 624 276 101 293 330
Base content (%) 37.6% 62.4%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 500 878 365 135 423 455
Base content per 1 kb (bases) 363 637 265 98 307 330
Base content (%) 36.3% 63.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 111 186 81 30 97 89
Base content per 1 kb (bases) 374 626 273 101 327 300
Base content (%) 37.4% 62.6%
ND5 (size: 1812 bases) GC AT G C A T
Base content (bases) 660 1152 488 172 534 618
Base content per 1 kb (bases) 364 636 269 95 295 341
Base content (%) 36.4% 63.6%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 186 333 155 31 104 229
Base content per 1 kb (bases) 358 642 299 60 200 441
Base content (%) 35.8% 64.2%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.54%)
Alanine (Ala, A)
n = 19 (8.41%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 20 (8.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 42 (18.58%)
Isoleucine (Ile, I)
n = 30 (13.27%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 15 (6.64%)
Phenylalanine (Phe, F)
n = 10 (4.42%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 5 (2.21%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 5 (2.21%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 11 10 10 3 17 0 12 9 0 3 2 7 0 6 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 6 8 5 0 3 1 3 1 6 3 6 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 6 0 3 5 3 0 0 3 1 2 0 0 4 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 1 0 5 0 1 1 3 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 64 78 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
19 65 38 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 57 95 73
ATP8 (size: 207 bases)
Amino acid sequence: MPQLDTSTWLITILSMILTLLIVFQLKILKFNYPLSPMLNLINKHLYTHPWETKWTKIYLPHSLPQQS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 5 (7.35%)
Threonine (Thr, T)
n = 7 (10.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.47%)
Leucine (Leu, L)
n = 14 (20.59%)
Isoleucine (Ile, I)
n = 7 (10.29%)
Methionine (Met, M)
n = 3 (4.41%)
Proline (Pro, P)
n = 6 (8.82%)
Phenylalanine (Phe, F)
n = 2 (2.94%)
Tyrosine (Tyr, Y)
n = 3 (4.41%)
Tryptophan (Trp, W)
n = 3 (4.41%)
Aspartic acid (Asp, D)
n = 1 (1.47%)
Glutamic acid (Glu, E)
n = 1 (1.47%)
Asparagine (Asn, N)
n = 3 (4.41%)
Glutamine (Gln, Q)
n = 4 (5.88%)
Histidine (His, H)
n = 3 (4.41%)
Lysine (Lys, K)
n = 5 (7.35%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 2 2 1 2 5 0 5 4 0 1 0 0 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 4 2 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 1 1 0 2 1 0 1 1 2 1 1 0 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 1 0 4 1 0 0 0 0 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 21 26 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 17 21 27
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 16 29 17
COX1 (size: 1542 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.16%)
Alanine (Ala, A)
n = 41 (7.99%)
Serine (Ser, S)
n = 32 (6.24%)
Threonine (Thr, T)
n = 35 (6.82%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.21%)
Leucine (Leu, L)
n = 58 (11.31%)
Isoleucine (Ile, I)
n = 38 (7.41%)
Methionine (Met, M)
n = 34 (6.63%)
Proline (Pro, P)
n = 28 (5.46%)
Phenylalanine (Phe, F)
n = 42 (8.19%)
Tyrosine (Tyr, Y)
n = 20 (3.9%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 14 (2.73%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 18 (3.51%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.51%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 15 31 12 9 20 2 14 4 2 5 9 23 0 18 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 8 15 17 1 15 10 18 4 14 8 6 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 16 0 7 8 13 1 0 3 12 8 1 1 10 8 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 2 10 4 9 0 3 1 4 0 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 103 137 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 133 96 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 140 200 157
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 12 (5.29%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 17 (7.49%)
Cysteine (Cys, C)
n = 4 (1.76%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 36 (15.86%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 14 (6.17%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 4 (1.76%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 6 12 5 5 19 0 7 6 0 1 4 6 0 5 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 2 5 4 3 0 4 1 3 0 3 6 4 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 7 2 5 4 7 0 1 3 6 4 0 0 4 0 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 14 1 5 5 5 0 1 3 2 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 62 61 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 58 59 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 57 101 65
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 10 (3.85%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 8 (3.08%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 8 11 10 6 9 0 7 6 1 3 4 8 0 12 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 1 12 2 0 3 13 5 0 3 5 2 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 0 9 1 6 0 0 3 6 5 0 1 5 3 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 1 1 3 1 1 0 1 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 63 62 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 64 56 99
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 95 90 71
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.07%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 26 (6.86%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 15 (3.96%)
Leucine (Leu, L)
n = 61 (16.09%)
Isoleucine (Ile, I)
n = 42 (11.08%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 21 (5.54%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 7 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 23 13 11 10 24 3 12 7 0 5 6 3 1 10 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 5 9 9 0 5 5 8 5 2 9 12 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 13 0 2 11 6 1 0 2 6 9 0 1 5 16 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 2 2 7 9 1 0 2 5 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 97 116 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 92 80 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 148 138 79
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 26 (8.18%)
Serine (Ser, S)
n = 24 (7.55%)
Threonine (Thr, T)
n = 24 (7.55%)
Cysteine (Cys, C)
n = 2 (0.63%)
Valine (Val, V)
n = 11 (3.46%)
Leucine (Leu, L)
n = 58 (18.24%)
Isoleucine (Ile, I)
n = 30 (9.43%)
Methionine (Met, M)
n = 19 (5.97%)
Proline (Pro, P)
n = 21 (6.6%)
Phenylalanine (Phe, F)
n = 18 (5.66%)
Tyrosine (Tyr, Y)
n = 15 (4.72%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 12 (3.77%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 2 (0.63%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 17 17 8 10 31 0 9 5 1 3 2 6 0 7 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 6 10 10 0 1 6 3 2 6 6 9 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 0 5 5 12 0 1 1 7 8 1 0 7 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 8 3 1 2 7 0 1 0 7 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 86 94 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 93 57 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 94 142 73
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.32%)
Alanine (Ala, A)
n = 17 (4.9%)
Serine (Ser, S)
n = 22 (6.34%)
Threonine (Thr, T)
n = 38 (10.95%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 69 (19.88%)
Isoleucine (Ile, I)
n = 38 (10.95%)
Methionine (Met, M)
n = 36 (10.37%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 18 (5.19%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 17 33 11 8 32 1 17 11 1 2 2 2 0 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 5 9 3 0 3 4 7 1 6 7 5 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 15 0 2 11 7 0 0 2 3 6 1 0 9 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 0 11 2 0 1 2 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 91 145 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 93 64 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 100 158 80
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.32%)
Alanine (Ala, A)
n = 17 (4.9%)
Serine (Ser, S)
n = 22 (6.34%)
Threonine (Thr, T)
n = 38 (10.95%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 69 (19.88%)
Isoleucine (Ile, I)
n = 38 (10.95%)
Methionine (Met, M)
n = 36 (10.37%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 18 (5.19%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 17 33 11 8 32 1 17 11 1 2 2 2 0 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 5 9 3 0 3 4 7 1 6 7 5 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 15 0 2 11 7 0 0 2 3 6 1 0 9 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 0 11 2 0 1 2 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 91 145 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 93 64 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 100 158 80
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 25 (5.46%)
Serine (Ser, S)
n = 40 (8.73%)
Threonine (Thr, T)
n = 38 (8.3%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 13 (2.84%)
Leucine (Leu, L)
n = 87 (19.0%)
Isoleucine (Ile, I)
n = 37 (8.08%)
Methionine (Met, M)
n = 43 (9.39%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 22 (4.8%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 26 (5.68%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 12 40 16 19 36 0 15 10 0 2 2 9 0 9 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 4 8 8 9 0 3 6 5 4 8 5 9 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 14 2 5 8 17 0 2 8 10 7 1 1 11 15 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 9 0 3 1 11 0 2 0 7 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 122 165 103
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 115 87 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 128 203 117
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.06%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 4 (4.08%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 11 (11.22%)
Methionine (Met, M)
n = 9 (9.18%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 4 (4.08%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 8 7 2 4 9 1 8 2 0 1 1 2 0 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 2 2 3 0 0 1 2 0 1 0 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 0 0 5 2 0 1 2 2 0 0 0 0 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
17 23 32 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 21 14 54
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 37 43 16
ND5 (size: 1812 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (4.31%)
Alanine (Ala, A)
n = 35 (5.8%)
Serine (Ser, S)
n = 55 (9.12%)
Threonine (Thr, T)
n = 56 (9.29%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 14 (2.32%)
Leucine (Leu, L)
n = 91 (15.09%)
Isoleucine (Ile, I)
n = 57 (9.45%)
Methionine (Met, M)
n = 47 (7.79%)
Proline (Pro, P)
n = 25 (4.15%)
Phenylalanine (Phe, F)
n = 46 (7.63%)
Tyrosine (Tyr, Y)
n = 16 (2.65%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 10 (1.66%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 34 (5.64%)
Glutamine (Gln, Q)
n = 18 (2.99%)
Histidine (His, H)
n = 13 (2.16%)
Lysine (Lys, K)
n = 24 (3.98%)
Arginine (Arg, R)
n = 8 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 29 45 12 12 51 2 14 17 1 4 1 8 1 18 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 3 6 14 15 0 4 7 12 3 5 9 11 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 28 1 15 16 12 1 4 7 10 6 1 0 13 21 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 11 0 5 5 23 1 0 4 3 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
96 141 229 138
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 160 127 255
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 187 262 141
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.7%)
Alanine (Ala, A)
n = 5 (2.91%)
Serine (Ser, S)
n = 18 (10.47%)
Threonine (Thr, T)
n = 5 (2.91%)
Cysteine (Cys, C)
n = 1 (0.58%)
Valine (Val, V)
n = 26 (15.12%)
Leucine (Leu, L)
n = 20 (11.63%)
Isoleucine (Ile, I)
n = 14 (8.14%)
Methionine (Met, M)
n = 11 (6.4%)
Proline (Pro, P)
n = 3 (1.74%)
Phenylalanine (Phe, F)
n = 13 (7.56%)
Tyrosine (Tyr, Y)
n = 6 (3.49%)
Tryptophan (Trp, W)
n = 5 (2.91%)
Aspartic acid (Asp, D)
n = 3 (1.74%)
Glutamic acid (Glu, E)
n = 8 (4.65%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 2 (1.16%)
Arginine (Arg, R)
n = 2 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 0 6 1 0 1 0 10 0 0 12 0 6 8 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 5 0 0 0 12 1 5 9 3 0 0 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 6 0 1 2 9 0 6 0 1 8 2 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 5 3 0 1 1 1 0 1 0 0 1 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 8 44 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 22 22 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
41 1 38 93
Total protein-coding genes (size: 11393 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 211 (5.56%)
Alanine (Ala, A)
n = 234 (6.16%)
Serine (Ser, S)
n = 286 (7.53%)
Threonine (Thr, T)
n = 306 (8.06%)
Cysteine (Cys, C)
n = 27 (0.71%)
Valine (Val, V)
n = 167 (4.4%)
Leucine (Leu, L)
n = 619 (16.31%)
Isoleucine (Ile, I)
n = 345 (9.09%)
Methionine (Met, M)
n = 257 (6.77%)
Proline (Pro, P)
n = 193 (5.08%)
Phenylalanine (Phe, F)
n = 237 (6.24%)
Tyrosine (Tyr, Y)
n = 131 (3.45%)
Tryptophan (Trp, W)
n = 105 (2.77%)
Aspartic acid (Asp, D)
n = 63 (1.66%)
Glutamic acid (Glu, E)
n = 96 (2.53%)
Asparagine (Asn, N)
n = 163 (4.29%)
Glutamine (Gln, Q)
n = 90 (2.37%)
Histidine (His, H)
n = 96 (2.53%)
Lysine (Lys, K)
n = 97 (2.56%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
192 153 231 104 94 266 10 132 84 6 42 33 81 11 110 127
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
26 11 16 59 94 80 1 54 55 73 29 64 61 68 0 68
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
97 134 7 61 75 89 6 20 35 71 60 7 13 71 92 41
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
55 82 14 34 29 90 7 9 14 39 1 1 1 6 3 98
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
771 916 1225 885
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
463 964 745 1625
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
142 1090 1554 1011

Failed to understand id: ?term=("Varecia variegata"[Organism]) AND (refseq[filter] AND mitochondrion[filter])


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.